Conserved Protein Domain Family
RPW8

?
pfam05659: RPW8 
Arabidopsis broad-spectrum mildew resistance protein RPW8
This family consists of several broad-spectrum mildew resistance proteins from Arabidopsis thaliana. Plant disease resistance (R) genes control the recognition of specific pathogens and activate subsequent defense responses. The Arabidopsis thaliana locus Resistance To Powdery Mildew 8 (RPW8) contains two naturally polymorphic, dominant R genes, RPW8.1 and RPW8.2, which individually control resistance to a broad range of powdery mildew pathogens. They induce localized, salicylic acid-dependent defenses similar to those induced by R genes that control specific resistance. Apparently, broad-spectrum resistance mediated by RPW8 uses the same mechanisms as specific resistance.
Statistics
?
PSSM-Id: 398988
Aligned: 13 rows
Threshold Bit Score: 150.136
Threshold Setting Gi: 75202748
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEF40015       3 ADL-----VGGAVLGAILGELLEAVLRAKNRTFMFKSILKRMECTLETVTPIVKEIEELNKVL-DRRNeEMGIIMKEIRK 76  castor bean
EEF40016       6 ASA-----AAGAGLELAFGSLLRIILEVRRKNVMFASTLQILIDTMEAIRPSIKRIDSFNTDF-DRPD-EIKGLRDLIRK 78  castor bean
CBI23299       3 lEL-----VGGAALGAVFEKLFAAVVDASNKATQFESSLKKLEETLKSINPSILEMKKLNDEL-DRPKeEMEKLIQILKD 76  wine grape
XP_010316804   3 GNL-----IGGAAIGQAFRMLSESITEAGKTSVCFDSNFRRLNSTLLSIKPVLEDIERLNKAL-EGREsETELFNKRLEE 76  tomato
Q9SCS6         4 AELaviktVGGPLIAAALGVGAQVIYDGFRKGKDT-SIINRLGRTMESISPVRDRIGKLSNVEgKPFReVHESLTRLLED 82  thale cress
Q9SCS7         4 SEI-----MAGAALGLALQVLHDAIKKAKDRSLTTRCILDRLDATIFRITPLVTQVDKLSEEVeDSPRkVIEDLKHLLEK 78  thale cress
XP_009115720   4 GEV-----LVGAALGITLQVLHEAIIKAKHRSLTTKCILDRLDATISRITPLVVHVDKISKRVeDSERkVIEELKRLLEK 78  field mustard
XP_009136547   3 IEL-----MAGAALGLALQVVHEAIKKAIERSLSTRYILYRLEDTISRITTFVAQVDKLSEEVeDSPRkIIEDLKNHLDN 77  field mustard
EFH52292       4 AEI-----IAGAALGLALQILHEAIQRAKDRSLTTSCILDRLDSTILRISPLIAKVEKLGKESdESMRkVIKDLKHLLEK 78  Arabidopsis lyr...
XP_002876032   4 VEL-----FAGAALGFALQLLHEAIIRAKERSLITRCILDRLDATIYKITPFVNKIDTCTEEVdEPLRkVIEELKCLLEK 78  Arabidopsis lyr...
ERN14425       1 mDL-----VSGAIIGAIAGEILKALLDATNIVYECKSQCEKLKSTLQHIVPKLEDIEQLRLQLtDCEPaDFKELKSRLES 75  Amborella trich...
EFH70101       1 -------mVGGAFLGAPVSEILKLVIEEAKKVKDFKPLSQDLASTMERLVPIFKEIDSMQ----QRCNgELIVLIKTLER 69  Arabidopsis lyr...
Q84WJ0         7 ASL-----VGGAALGAPLSEIFKLVIEEAKKVKDFKPLSQDLASTMERLVPIFNEIDMMQQGS-NRGTsELKVLTETMER 80  thale cress
EEF40015      77 GKKLVLECSGMQwYYACWRTPKYAGKLIKLEKSLKLFFQIVMQAQRARDGKEALLE--MKDLRMDLKR 142 castor bean
EEF40016      79 GEDLVIKCSKVH-KYNYVKKPYYTKKLIKLDESIRRYISTILPLYQTSDIKETLYE--MRVLSTQIRN 143 castor bean
CBI23299      77 GEKLIHKCSKVS-CCSCFKKWRYANKIEALEDSLLNFFQVELQAQLGRNNVEILVM--LKSNRFSlsn 141 wine grape
XP_010316804  77 GEKLVRKSAKIK-RYNVCKRWYYSKKLADLEKSTMNFFEVHGLMQSCRDRKKILVA--LKEEGEKLDE 141 tomato
Q9SCS6        83 AKSIIEKYWKLRwSRHVCRKYRYIKKLESIELELVR-VAREIQVHQWTDIKEMKAI--QVHQWTDIKE 147 thale cress
Q9SCS7        79 AVSLVEAYAELR-RRNLLKKFRYKRRIKELEASLRWMVDVDVQVNQWVDIKELMAK--MSEMNTKLDE 143 thale cress
XP_009115720  79 AVSLVEAYAELR-RRNLHKKHWCKSRIKELEASLRWMVDVDVQVNQWLDIKELVTK--MSEMNTKLDK 143 field mustard
XP_009136547  78 AASLLKAYAELR-RRNLIKKYRCRRSIKELEASLRCMINVDVQVNHW-DIKKLMAT--MSETNTKLQp 141 field mustard
EFH52292      79 AVVLVEAYAELK-RRNLVGKYRYKRRIKELEGSLKWMVDVDVKVNQWADIKDLMAK--MSEMNTKLDK 143 Arabidopsis lyrata subsp. l...
XP_002876032  79 AIRLVEAYAELK-RRNLLRKYRYKRRIKELDASLRWMVDVDVQVNQWLDIRKLMGK--MSEMNTKLDE 143 Arabidopsis lyrata subsp. l...
ERN14425      76 GKVLVYKCMKLR-FWKVHKKYSYGKKLIELDEYLVRFFDLNLAADTNLDTKQLRIE--FKEMRRLLDg 140 Amborella trichopoda
EFH70101      70 AEKMVSKCSGVK-WYSISKKALYTREIKEINQEFLKFCQIELQLIQHRNQLQSMQS--MASVTMNIDL 134 Arabidopsis lyrata subsp. l...
Q84WJ0        81 AGEMVHKCSRIQ-WYSIAKKALYTREIKAINQDFLKFCQIELQLIQHRNQLQYMRSmgMASVSTKADL 147 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap