Conserved Protein Domain Family
Miff

?
pfam05644: Miff 
Mitochondrial and peroxisomal fission factor Mff
This protein has a role in mitochondrial and peroxisomal fission.
Statistics
?
PSSM-Id: 398976
Aligned: 21 rows
Threshold Bit Score: 239.733
Threshold Setting Gi: 241743325
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_016156122  13 MAEMSRLQYEMEYTEGISQRMRVPEKLKVAPQNS--ELDKGGQE-G----FPN----ASVTMQVPERIVVAGNSEDIPFS 81  Collared flycat...
XP_011484419  12 vTEISRIHYDLEYMEGISQRMRIPETLKVGPESS--AGRMQAQE-P----PPP----HSTLMQVPERIVVAGDDGDLTFP 80  Japanese medaka
XP_005802419  12 VAEINRIHYELEYTEGISQRMRIPETLKVAPESR--SGAALLQP-P----LPV----HTTLMQVPERIVVASDNGESRFV 80  southern platyfish
3_pfamImport   1 VAEMDRIHFELEYTVGISQRMRIPETLKVASENH--PGSLSLQH-P----LPL----HTTMMQVPERIIVAGDDGDLQFS 69 
XP_005171224  12 MAEVNRIHYELEYTEGISQQMRIPERLKIASGSS--EEPPGLLNaS-----------HSTMMHVPERIVIAGDDNDARFG 78  zebrafish
XP_002412416  12 fsgdydAFYDPEFTAEISNKMRVPQKISVVDQ----DEYKLIEDmG----PNKlhfnDAAYMHVPDRILVRGGNQHIEGR 83  black-legged tick
EDW35932      14 L--DDDLYNEAKFAHEINDKMRVPKRIKATGEYS--DEDLLLSNqNgnqfISSwnyhDKIDMNVPDRIVVLGHNQHLETR 89  Drosophila pers...
XP_001866796  12 NYEDDALYQNAAFTHDISEQMRVPKRIRATGGSYfdDEPELLSNgNg--eINSwnyhNKIEMNVPDRIVVLGQDQHLGTK 89  southern house ...
XP_321339     12 NYDDDAMFQNAAFTHDISEQMRVPKRIRATGDYY--DDQDLLPNgNg--eINSwnyhNKIDMTVPDRIVVLGQDQHLGTK 87  Anopheles gambi...
XP_005476071  13 VAEMNRIHFELEYTEGISQRMRIPETLKVAPESQ--TGSMPLQQ-P----LPT----HTALMQVPERIVVAGDDEDPRFA 81  Nile tilapia
XP_016156122  82 RP-ADLDILQST-P-FK--P-LALKTPPRVISLSDRPLDFLDLEkpPQqTPQSEE-VRSVGRLKRERSMSEN--APRHNG 152 Collared flycat...
XP_011484419  81 RP-RDLDLIQSV-P-PA--DlLNMKAPPNVLTLTEQPLDSLETDqtANaQRNSSN--ATSLHARARRERSDNv-SSRHGN 152 Japanese medaka
XP_005802419  81 QP-RDLDLIQSV-P-SV--DlLNMKAPPRVLTLTEQPLDSLEMDqaANsQSNPSQtASYSTRSRRERSASENi-PGRHGS 154 southern platyfish
3_pfamImport  70 HP-RDLDLIQSL-P-PM--DlLSMKAPPRILTLSEQPLDSLETEqtATsQSNPIHaAHFHARPRRERSASENl-SGRHSN 143
XP_005171224  79 RP-RDLDLIQST-P-LE--T-VELKTPPRVLTLNDQPLDFLEPEpaANsTAQPREeMKSHFRSRRERCRSENs-TMRRNG 151 zebrafish
XP_002412416  84 DPlPETRLEQSLvGsAE--EtILLSTPPRTLTLDMHAYPAVDME------DENAE-NRSALKFRRKTTLSKL-----HNG 149 black-legged tick
EDW35932      90 SApREIQLENSIlPkNPsaSyARVQTPPRVITLTDHHF--------PSaSEESSP-IRANGHHLYGQDQDYDedEQGNAT 160 Drosophila pers...
XP_001866796  90 SApREIMLENSIlPkDP--GfVRVSTPPRVITLSEHHF--------PSaSDELED--EDRDLTMRGDGGDDDdyEPRSLD 157 southern house ...
XP_321339     88 SApREIMLENSIlPkDP--GfVRVSTPPRVITLSEHHF--------PSaSDEPEE--------NAKDNHQEDnyGPASLE 149 Anopheles gambi...
XP_005476071  82 CP-RDLDLIQSI-P-PA--DlLNMKAPPRVLTLTEQPLDSLETDqtVNsQRNPSQaANFHGRPRRERSASENv-SGRHSS 155 Nile tilapia
XP_016156122 153 QLARNDSMwhrsdtvprnkmprfqsplstkdctVTPSLQQARVCPPNMLPED-GINLYSARGILSFIQSSTRRAYQQVLD 231 Collared flycat...
XP_011484419 153 QISRGDVSv-----------------------tSSPHAPPLRLCPPLYSPEDaNINLFTAAGLLSYIQSTTRRAYQQVLE 209 Japanese medaka
XP_005802419 155 HCSRGDVRffqpsp--------------casvtPSPSAPPVRLCPPLCSPEDaNINLYTAAGFLSYVQSTTRRAYQQVLE 220 southern platyfish
3_pfamImport 144 QIVRGDASyadftpeknlislpflptyfsdsvtPSPSAPPVRLCPPLCSPEDaNIHLFTTAGFLSYVKSTTRRAYQQVLE 223
XP_005171224 152 QINKHDFAs------------------------PSPSRAPVRVCPPLISPED-SQNLNSASGVLNYIKSTTRRAYQQVLE 206 zebrafish
XP_002412416 150 DITFVNs----------------------------------------------GVNVHHSQNDFNFVACVSEIGATHNSH 183 black-legged tick
EDW35932     161 QYVRANg----------------------------------------------TARMGFHTNDANSVESDSQ-------- 186 Drosophila pers...
XP_001866796 158 SMLGAE----------------------------------------------------AVGGGGGSVGKGGQRQRQQQQQ 185 southern house ...
XP_321339    150 SIEDPN----------------------------------------------------------SSNAYFSRPSL----- 166 Anopheles gambi...
XP_005476071 156 QISRGDVSv-----------------------tPSPSAPPVRLCPPLCSPEDvNINLFTAAGLLSYIQSTTRRAYQQVLE 212 Nile tilapia
XP_016156122 232 VLDENRSldkdnrpMLRGGSAATTsSNPHHD---------NTRYGLSNLDtTTLEGTP------DDMTVVDAASLRRQII 296 Collared flycat...
XP_011484419 210 VLDDGH---------R-----------------------------RTHLD-STLDINP------DESGLVDASSLRRQIV 244 Japanese medaka
XP_005802419 221 ILDDSH---------R-----------------------------RTHLD-LALDMNP------DESGLVDASSLRRQIV 255 southern platyfish
3_pfamImport 224 VLDESHR-------RVMNGARLCGhYAPVHQ-----------SFLGTHLD-LALDINP------DESGLVDASSLRRQIV 278
XP_005171224 207 VLDDSQR-------G---------------------------RASLVTFD-ASVENTP------DDAGLTDAASLRRQII 245 zebrafish
XP_002412416 184 RIEPWTPvqhpfkgS-----------------------------PRPSFC-RSAPATPpgipgsDD----ELGMLKRQIR 229 black-legged tick
EDW35932     187 ---------------LTTGSASKRsQLNQQQhnnldasmlAQREGTPMGE-----LTP------HE----EILYLRRQLA 236 Drosophila pers...
XP_001866796 186 RFGAGR---------GVNGELQRKtAFAKHNssel-vlgrSFREETPTFGgSVENLTP------AE----EMTHMRRTVA 245 southern house ...
XP_321339    167 ---------------AHGREPSKRsAFSKYNnelt--ltrSMREETPTFGgSVENLTP------SE----ELTHLRRQVA 219 Anopheles gambi...
XP_005476071 213 VLDDSHR--------------------------------------RTHLD-LALDLNP------DESGLVDASSLRRQIV 247 Nile tilapia
XP_016156122 297 KLNRRLQLLEEENKERAKREMIMYSITVAFWLLNSWLWFRR 337 Collared flycatcher
XP_011484419 245 KLNRRLQLLEEENKERSKREMILYSATVAFWLINTWIWLRR 285 Japanese medaka
XP_005802419 256 KLNRRLQLLEEENKERSKREVALYSTTVAFWLINLWIWLRR 296 southern platyfish
3_pfamImport 279 KLNRRLQLLEEENKERSKREVILYSATLAFWVINTWIWLRR 319
XP_005171224 246 KLNRRLQLLEHENKERAKREMVMYSLTVAFWLVNSWIWLRR 286 zebrafish
XP_002412416 230 NVSRRLVAVEQENQQRQQREVVLYSVGLLYFLLKGLFWLNR 270 black-legged tick
EDW35932     237 KLNRRVLNIEINNEQRMQREKIVYCLGLAYFVLKTIFWLNR 277 Drosophila persimilis
XP_001866796 246 KINRRLLAVEIDNAQRQQREKIIYCVGLAYLLLKTFMWLSR 286 southern house mosquito
XP_321339    220 KINRRLLAVEIDSVQRQQREKIIYCVGMAYFLFKTFMWLSR 260 Anopheles gambiae str. PEST
XP_005476071 248 KLNRRLQLLEEENKERSKREVILYSATVAFWLINTWIWFRR 288 Nile tilapia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap