Conserved Protein Domain Family
DUF799

?
pfam05643: DUF799 
Putative bacterial lipoprotein (DUF799)
This family consists of several bacterial proteins of unknown function. Some of the family members are described as putative lipoproteins.
Statistics
?
PSSM-Id: 398975
Aligned: 30 rows
Threshold Bit Score: 261.802
Threshold Setting Gi: 123533004
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015877803    29 LDYTAFKRSQPKSILVLPPVNNTNDVKASFGVLSQVTQPLAESGYYVVPVGPMEETFKYNGLTSPNDIAEVSPAKLREIF 108 Burkholderia ...
PNU:H681_25190  25 VDYSAFKQSRPKSILVLPPLNESPDVKASYGMLSQITYPLAEAGYYVLPVALVDETFRQNGVSTPADIHQLPAGKLREIF 104 Pseudomonas s...
Q4KAD7          27 VDYSAYKQARPKSILVLPPLNESPDIKATYSMLSQVTFPLAEAGYYVMPIAVVDETFRHNGLTNPADIHGLAPAKLNEIF 106 Pseudomonas p...
Q8XS06          28 VDYAAFKASKPRSIVVLPPLNQSPDVKATYGMLSQVTKPLAEAGYYVLPVALVDETFRQNGLTTAGDIHGVPVAKLKDIF 107 Ralstonia sol...
Q0K4M2          28 VDYAAFKESHPRSIVVLPPLNNSPDVKATYALLSQATQPLAESGYYVLPVALVDETFRQNGLTIPGDIHAVAPAKLREIF 107 Cupriavidus n...
Q1LCD0          28 IDYSAYKASRPRSIVVLPPLNESPDINATYAMLAQTTAPLAESGYYVLPVALVDETFRQNGLTVPGDIHAVPVAKLREIF 107 Cupriavidus m...
Q7DDE8          25 FDYTSFKESKPASILVVPPLNESPDVNGTWGVLASTAAPLSEAGYYVFPAAVVEETFKQNGLTNAADIHAVRPEKLHQIF 104 Neisseria men...
Q2SHH4          29 YDYSALLASKPRSILVIPPQNNTVEVNAPYIFLSTISAPLAEKGYYVFPVAVIDQFLKDNGLPTPAEMNSVPLDKLREHI 108 Hahella cheju...
WP_010786415    25 YDYTELKNSKPKSILVVMPTNSSVDAKADTSVLARTSYPLGELGYYVFPVALVDEIFKQNGLTDGNAIRSAKTNKIREIF 104 Glaesserella ...
WP_013791757    28 YDYSAFKESSPASILVLPPVNKSPDIKATYSMYSLITAPLSEAGYYVLPVAVVNETFKQNGMANAEEIREVPPQKLYEIF 107 Pseudomonas
WP_015877803   109 GADSALYMTVTRYGTTYQVIDSVTAVSVSAKLVDLRTGDVLWTGSQSATDKELGGmqggvQGGGMVGLfvnLAQAAVKQI 188 Burkholderia ...
PNU:H681_25190 105 GADAGLYVTVTEYGTSYMVLSSASIVTASARLVDLRSGTTLWTGTATASSEEGSQ-----NSGGLVGM---LISAAVKQI 176 Pseudomonas s...
Q4KAD7         107 GADAGLYITVKEYGTSYMLISSATVVTASATLVDLKTGTTLWTGSARASSEEGNNg----NNGGLVGM---LITAAVKQI 179 Pseudomonas p...
Q8XS06         108 GADAALYVTITQYGTKYMLIDSVTVVAADAKLVDLKSGETLWTGHASASSKETGNsv-dvNAGGIIGV---LVSAAVKQI 183 Ralstonia sol...
Q0K4M2         108 GADTALYITVTDYGPKYQVVSSTTVVAAEAKLLDLRTGKTLWTGQASAANNQSGN-----AGGGLIGA---LIGTAIAHA 179 Cupriavidus n...
Q1LCD0         108 GADAALYVTVSEYGSKYQVLSSVTRVAASAKLVDLKTGDALWSGSAAAATDDSGN-----AGGGLVGA---LIAAAVAQV 179 Cupriavidus m...
Q7DDE8         105 GNDAVLYITVTEYGTSYQILDSVTTVSAKARLVDSRNGKELWSGS--ASIREGSNn----SNSGLLGA---LVSAVVNQI 175 Neisseria men...
Q2SHH4         109 GPDAVLYVTIDDWGQQYQIISSVAVVSSSWRLIDARTGETLWQGRAYAQQSSGDG-----GGNGLAGM---LVAAVVEQV 180 Hahella cheju...
WP_010786415   105 GADAIFYVNIEEYGTSYKLIDSVTNVSLEGKLVDLKTGKTLWEGAGSFAQGSSNS-----NDGLLVM----LVKAAVSQI 175 Glaesserella ...
WP_013791757   108 GADTVLYIDVTEYGSSYKVISSEVAVAASATLVDLRTGKELWKGVARASTAEQQQn----SGGGLAGI---LITALVNQV 180 Pseudomonas
WP_015877803   189 AKTV-TDESVDVAGLTNAKLLSAGSPNGLLYGPR 221 Burkholderia glumae
PNU:H681_25190 177 ISSAqEDASYPIAGITGARLLSAGHNGGLLYGPR 210 Pseudomonas sp. ATCC 13867
Q4KAD7         180 INTS-TDAGHPIAGITSQRLLSAGQRTGLLYGPR 212 Pseudomonas protegens Pf-5
Q8XS06         184 VNTA-IDSGYSVAGATSARLLSAGPHGGLLYGPR 216 Ralstonia solanacearum
Q0K4M2         180 ISSV-SDAAYGVAGRTSQQLLSAGTPGGILYGPR 212 Cupriavidus necator H16
Q1LCD0         180 INHT-VDRSYGVAGAASDRLLSAGQPTGILYGPR 212 Cupriavidus metallidurans CH34
Q7DDE8         176 ANSL-TDRGYQVSKTAAYNLLSPYSHNGILKGPR 208 Neisseria meningitidis MC58
Q2SHH4         181 VNSV-SDKTPELSANANYRTINS-PGNGLLPGPY 212 Hahella chejuensis KCTC 2396
WP_010786415   176 MDTS-KDKGYQIAAPATSNLVHLGKNGGLLIGPK 208 Glaesserella parasuis
WP_013791757   181 MNSL-NDRGHEIAGITSSRLLSSNAVNGILPGPR 213 Pseudomonas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap