5Y0O,5Y0S


Conserved Protein Domain Family
HIGH_NTase1

?
pfam05636: HIGH_NTase1 
Click on image for an interactive view with Cn3D
HIGH Nucleotidyl Transferase
This family consists of HIGH Nucleotidyl Transferases
Statistics
?
PSSM-Id: 398971
Aligned: 152 rows
Threshold Bit Score: 316.789
Threshold Setting Gi: 496306591
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5Y0O_A        21 MKAVGLVVEYNPFHNGHLYHAQTAKLQTGCDTAVAVMSGHFLQRGEPAVVSKWARTKMALQSGVDLVIELPYLYAVQKAD 100 Bacillus subtilis
WP_002304752   3 MKSCGIIVEYNPFHNGHRYHVEMARKITGAEVVIAVMSGNFLQRGEPAIIDKWHRANEALQNGVDLVVELPVEWAVQSAD 82  Enterococcus fa...
BAO06544       1 MKVCGIIVEYNPFHNGHLYHVQQARERTGADVVIAVMSGNFLQRGEPAILDKWQRAEVALKNGVDLVVELPIEWAVQSAD 80  Enterococcus mu...
EOU05487       1 MKICGIIVEYNPFHNGHRYHAEMAREQTGADIVIAVMSGNFLQRGEPAIIDKWSRATAALQNGVDLVIELPIEWSVQSAD 80  Enterococcus hi...
Q830C2         1 MKACGIIVEYNPFHNGHRYHAQQARQQSGAEVVIAIMSGNFLQRGEPALLDKWARAEEALQNGVDLVIELPTAWSVQSAD 80  Enterococcus fa...
WP_014124651   1 MNTCGIIAEYNPFHNGHRYQLQEARERTQADVMVVVMSGNFLQRGEPAIIDKWQRAEEALSQGADLIVELPIQWSLQSAD 80  Tetragenococcus...
WP_015509577   1 MKACGLVVEYNPFHHGHQYHVEKARQVTNADVVVAVMSGNFLQRGEPAIIDKWQRAQAALQHGVDLIVELPPAWAVHSAD 80  Enterococcus ca...
EQC80494       1 MQACGIVVEYNPFHNGHEFHVQQARKASGADVVVAVMSGNFLQRGEPAIVDKWQRARAALENGVDLIVELPPAWSVQSAD 80  Enterococcus sp...
CDE28121       1 MKILGIITEYNPYHLGHRLHLQEAKKLILPDLTICVMSSSFVQRGEPAMISYQKRAAIAIEEGIDIVIELPLVYACQSAD 80  Catenibacterium...
Q8RFG6         3 eNVVGLIVEYNPFHNGHLHHIQEIDRLFEDNIKIAVMSGDYVQRGEPSLINKLEKTKIALSQGIDIVIELPTFYSTQSAE 82  Fusobacterium n...
5Y0O_A       101 IFARGSVSILNELECEALFFGSENGDIKPFLETAQLIDEHKHILNDRIKEELKKGASYPAAAAIAFSSilhtesalDLSK 180 Bacillus subtilis
WP_002304752  83 YFAKGAVKILQTLDCDSLCFGTEEETSFDYSSFGRFVQENQDRIEEAFQELSDQTYSYPQKMTEVFRSlypd-itlDFSS 161 Enterococcus fa...
BAO06544      81 YFAKGAVQLLQKLNCDYLCFGTEDEATFDYQAFGQFVLHHQDQITKAFQELPDQTMSYPQKMTQVFKHvype-islDFSS 159 Enterococcus mu...
EOU05487      81 YFAKGAVRLLQMLGCTHLCFGTEEESTFNYEAFGKFVQQNQLRIDREFQRLSDQGMSYPQKMTAVFNTlype-ialDFSS 159 Enterococcus hi...
Q830C2        81 YFAKGGIKLLQALQCESLCFGTDSTSAIDYAAFGQFVQENQSLIDQTFHALTDKQLSYPQKMTAVFRQvype-srfDFSS 159 Enterococcus fa...
WP_014124651  81 YFAKGGVQLLHALHCKSLSFGTDHSADFDYSFFGHFTTTHQKAIDEAYQKYDDPTLTYAQKMATVLADddpa-farLKEQ 159 Tetragenococcus...
WP_015509577  81 FFASGAIRILQDLQCELLCFGTDTKHPFDYAKFAHFEKENQLMIDDAFQRLARQNATYSQKMSAVLSElype-yheEKDQ 159 Enterococcus ca...
EQC80494      81 FFAKGAIRILQSLDCSFLCFGTDAPEPFDYEAFAHFERNNQEVIDQFFQENASENQTYTQKMHAAFAAvypd-flaEAHL 159 Enterococcus sp...
CDE28121      81 YFAKGAVTLLHEMGVTDLVFGSEDGNIETFIEIAEGIEQDPDTYNMKVKEGMKDGLRYPDACNQALQfil----nkEVRT 156 Catenibacterium...
Q8RFG6        83 IFAKGSVNLLNKLSCSHIVFGSESNDLDKLKRIA--TISLTKEFELSLREFLAEGFSYPTAFSKVLFD--------EKLG 152 Fusobacterium n...
5Y0O_A       181 PNNILGYQYVTSILTGGYPMKPYTTARISSDYHDADLPeGEnhIASATSIRKAMiGQN-------LEA--CLRFLPAASA 251 Bacillus subtilis
WP_002304752 162 PNHILGLSYAKENAKYVHPMELHPIRRKSAGYHEKIITdq--rIASATAIRHAL-----------EEGkrIAGLVPPQTE 228 Enterococcus fa...
BAO06544     160 PNHILGLSYAKENATYEHPMELVPINRKGAGYHDEELPke--tIASATAIRKAL-----------TENrsISATVPSETE 226 Enterococcus mu...
EOU05487     160 PNHILGLSYAKENAQYAQPMKLVPITRKSAGYHDEEWSss--sIASATAIRKAL-----------SEQrsVTNFIPAATA 226 Enterococcus hi...
Q830C2       160 PNHILGMSYAKENATYPTPMTLYPIARKQAGFHDATISg---kVASATAIRQSVf---------qQEItqVLPTVPSITA 227 Enterococcus fa...
WP_014124651 160 PNHVLGLTYAKENARFEQAMGIYPIERKKVNHHSAELTg---kIASATAIRQAV-----------FEKnsVKNVVPVKTA 225 Tetragenococcus...
WP_015509577 160 PNHLLGMVYAREVLHYEKPMRLVPIQRVAASYHSEQFDhp--tIASATAIRQAI-----------KQGaaVVDFVPEATQ 226 Enterococcus ca...
EQC80494     160 PNHILGMRYARETCQYPSPMKLLPISRKQAAYHSQELSgg--mIASATAIRKAV-----------KAGqeIKGYVPESVR 226 Enterococcus sp...
CDE28121     157 PNDLLGLSYVKEVVHHHYPISMHCIKRTN-DYHAK----DIeqISSATSLRIAL-----------KHGidVAHQLPGYE- 219 Catenibacterium...
Q8RFG6       153 SNDILALEYLRAIKTINSKIEAYCIKREKTGYYDDEKDn----FSSATYIRKIL-LDSnekkenkLNK--IKNLVPEFSY 225 Fusobacterium n...
5Y0O_A       252 RELAAYrkSFglwHT--PESYFSYLKYSLSTVTARELQQVYEVEEGLEHRIIRSIRKSSSYQEFMELLKTKRYTWTRLQR 329 Bacillus subtilis
WP_002304752 229 EDLSTC--S-----LqtWESYWPYLRYRLLSSTLLELTDIYQMTEGIESRMKTAAATADSFEDFVSKVKTKRYTWTRIQR 301 Enterococcus fa...
BAO06544     227 RFLKTE--S-----LqtWTSYWPLLKYRLLSSTVDSLQKIYQMTEGLEIRMLEAAKTANTFYEFVEQVKTKRYTWTRIQR 299 Enterococcus mu...
EOU05487     227 AMIEAG--S-----QqtWANYWPLLRYRLLSTELANLKTIYQMTEGLEVRMQSAAKKATSFEEFVTLVKTKRYTWTRIQR 299 Enterococcus hi...
Q830C2       228 QHLQTQ--T-----MisWENYWPFLKYKIVQSSLEELQAIYQMTEGLEYRLKDQIQAAGSFHELMERMKTKRYTWTRLQR 300 Enterococcus fa...
WP_014124651 226 KDLTNY--------QvsWEDYWPFLRYKILASSLAELREIYQMVEGLEYRLKSKIRQASNFEEYVQLVKSKRYTRARIQR 297 Tetragenococcus...
WP_015509577 227 TFLSQA--------TvdWEDFWPYLQYQIISAPIEKLAAIYQMEEGLEYRLKQYVTAADSFADFIKLLKTKRYTQTRLQR 298 Enterococcus ca...
EQC80494     227 NDLLDQ--------TidWEFFWPLLQYQLIATPLEQLRTRYQVTEGLEYRIKDCLHAT-SFAEFMALLKTKRYTRTRLQR 297 Enterococcus sp...
CDE28121     220 -TYKDS--H-----FftLEEFYPYLKYLITFTP---LEGLHMIEEGLDDRLYKVNQETCNLEELINALTSKRYTRSRIQR 288 Catenibacterium...
Q8RFG6       226 KILEEN--FG---VFscLSDFYDLIKYNIIKNCSE-LKNIQDLEIGLENRLYKYSLENLKFEDFFNEVLTKRITISRLQR 299 Fusobacterium n...
5Y0O_A       330 MNTHILTRTKKQDMqklldnDkaP-YIRLLGMTKKGQAYLSEKKKA-L--SVPLVSKLSSFS------HPAL-DLDVKAS 398 Bacillus subtilis
WP_002304752 302 LSCYVLLNIKKQEIpvq---qnkN-YLRLLGFTDAGRRFLKEKK------EISIYSRIGKKEa-------qEaELLVRSD 364 Enterococcus fa...
BAO06544     300 LSCYVLLNIQKEEMreq---qmqE-YINVLGFTAAGRACLKNKK------ALALFAKIGKKEa-------qVaKLLVRSD 362 Enterococcus mu...
EOU05487     300 LACYVLLNIHHEEIhdq---qakC-YLNILGFTKAGQQFLKEKK------EIPLISKIGKKEa-------eLaHLLVRSD 362 Enterococcus hi...
Q830C2       301 LATYILLNMTKEEVetv---wqnS-YLHVLGFTPKGQAYLKETKAQ-I--QLPVISKVSKENr-------aMlSLDIRAN 366 Enterococcus fa...
WP_014124651 298 LFCYCLLNLKDKDVkka---whnN-YLHILGFTQKGQQYLQQEKKT-I--SWPIISKVGQTEe-------eKmTLGIQSD 363 Tetragenococcus...
WP_015509577 299 LACYVLFQVTKAEMkea---qehS-FIRVLGYTKQGQHYLKEVKKE-L--TLPLIAKFGKQEa-------qRyGLSLRID 364 Enterococcus ca...
EQC80494     298 LMCYLLFQATSEEVqqa---qknT-GIRILGFTTAGQTYLKQVKKK-T--DLPLISKFGKKEs-------eRfGYSLRVD 363 Enterococcus sp...
CDE28121     289 MLIHILLHNTKEEIkka---mdiD-YIHILGLSTKGQRYIKTAKKN-T--EYQIITNITKH-------KHPAlDIEKRGA 354 Catenibacterium...
Q8RFG6       300 ILLHSLFNLTENITek---vKneVpFVKILGFSTKGQKYLNYLKKSkNynERKILTSNRNLKeilneeEAKLfNFNELCS 376 Fusobacterium n...
5Y0O_A       399 ---RIY-SLPIEePLRTEF 413 Bacillus subtilis
WP_002304752 365 ---QIY-------QLGGNI 373 Enterococcus faecium
BAO06544     363 ---QIY-------RLGGEV 371 Enterococcus mundtii QU 25
EOU05487     363 ---QIY-------QLGGAI 371 Enterococcus hirae ATCC 9790
Q830C2       367 ---QLY-QMGDS-----SL 376 Enterococcus faecalis V583
WP_014124651 364 ---NIY-QMVNT-----KI 373 Tetragenococcus halophilus
WP_015509577 365 ---QIY-QQGNP-----QI 374 Enterococcus casseliflavus
EQC80494     364 ---QIY-QLASP-----QI 373 Enterococcus sp. HSIEG1
CDE28121     355 qllDLVdSGFFKetikaip 373 Catenibacterium sp. CAG:290
Q8RFG6       377 ---QIY------------R 380 Fusobacterium nucleatum subsp. nucleatum ATCC 25586
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap