2RLD,2GSC


Conserved Protein Domain Family
23S_rRNA_IVP

?
pfam05635: 23S_rRNA_IVP 
Click on image for an interactive view with Cn3D
23S rRNA-intervening sequence protein
This family consists of bacterial proteins encoded within an intervening sequence present within some 23S rRNA genes. It folds into an anti-parallel four-helix bundle and forms homopentamers.
Statistics
?
PSSM-Id: 398970
Aligned: 375 rows
Threshold Bit Score: 35.5125
Threshold Setting Gi: 378575922
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2RLD_D            7 KDNVVKDKSLEFAVRIVN-LYKFLVNEqKEFVXSKQILRSGTSIGANIREAEQA-QSRADFINKLNIALKEANETEYWLE 84  Bacteroides ...
ASGPB:SGRA_2194   7 KQSLVWQKTAGFCKALQLgLN-SC----EQSWYKDSLLLTASRAVNQVALGQEQ-FHKMAQEQYLLDARQSLSECRSMLA 80  Saprospira g...
jgi:Paes_2388    12 RDLPVFVKWLDFLEWLLP-VTERFPKR-VRFTFSDRINQLALDVVEDLIEA----RYTKEKQAHLRRANLRLEKLRVLLR 85  Prosthecochl...
WP_005223263      7 EDLPIFTAWMQFLEWLLP-ATEKFPKR-VRFTFADRINNLALDIAEDLVEA----RYTRDKAAILRRVNLRLEKLRVLLR 80  Marichromati...
EGA93021          2 EELKILQKTFDMMNYAYP-ALAQYPKG-EKFALVVDIKRCMDVMLERIIEANKK-YYKKTT---LQELDVEVEKLKAYVR 75  [Clostridium...
jgi:Sgly_2597     1 ---MLQKKAEIFLDRIYP-LLRNFPQS-EKFCLCQEIKQACYRVIRNTMM-YSA-LKTDDRIHYLREVDADLKLLLIHFG 73  Syntrophobot...
CCZ00225          9 GTLIIYPKYMDLVYYSND-LVRKFPKC-EQFALVKEIKSTLYSGLRCIIYAIKL-YNKQDKLRYLRELDVNLNLLKVHIR 85  Clostridium ...
WP_012376565      7 QELDVYREAFHLQQEIFA-VSQKWPKE-ETYSLIDQVRRSSRSVGANLSEAWAKrRYPAHFLSKLTEADGELSETRHWIA 84  Opitutus terrae
CDE13762          6 SNLIIYQKYIELIEYTNN-ILRKYPKS-ETFALVKECKSTLYSGLRLLIYAIKS-YQKKDKLKYLNELDTNLHILKVHIR 82  Clostridium ...
CDE84048          7 nSLLIYKYYLDLVYYTNT-LCIKYPKS-EKLALASETKQSLYSGLRELIYALKE-YNKKNKIGHLNNLDVELNLQKVYLR 83  Clostridium ...
2RLD_D           85 LLIRTEYITREQYESINNDSTEINKLLIS 113 Bacteroides thetaiotaomicron VPI-5482
ASGPB:SGRA_2194  81 LGLELQLLGPNIQEELEAKANEAAAVLYG 109 Saprospira grandis str. Lewin
jgi:Paes_2388    86 LSQRMHFLDYKRFEYAMKYINEVGKMLGG 114 Prosthecochloris aestuarii DSM 271
WP_005223263     81 LCHRLQYLPHAGYEHAAKSINGVGRMLGG 109 Marichromatium purpuratum
EGA93021         76 LSYNLGFLPPKKYEQWSGLVVEIGRMVGG 104 [Clostridium] symbiosum WAL-14163
jgi:Sgly_2597    74 MARNQKYITQKKAYELQEKISELGRICGG 102 Syntrophobotulus glycolicus DSM 8271
CCZ00225         86 ISYKYKYITMNNYQTWSNQLTDISNLLGG 114 Clostridium sp. CAG:793
WP_012376565     85 TAQACRYLQDKISAALSSDADRVGKLLGA 113 Opitutus terrae
CDE13762         83 LSYKFRYISIQNYQSWSKLITDICNMLGG 111 Clostridium sp. CAG:470
CDE84048         84 LAYKYKYISKQNYETWSKKITEICNMLGG 112 Clostridium sp. CAG:273
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap