Conserved Protein Domain Family
APO_RNA-bind

?
pfam05634: APO_RNA-bind 
APO RNA-binding
This domain contains conserved cysteine and histidine residues. It resembles zinc fingers, and binds to zinc. This domain functions as an RNA-binding domain.
Statistics
?
PSSM-Id: 398969
Aligned: 12 rows
Threshold Bit Score: 313.149
Threshold Setting Gi: 68565076
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004976806  49 RKRQAeyeqQPQNVDLP-ELQPKNKKKPFPVPIKKMLQDSRRDKRLAQMRIEKPLE-APKNGLLVPELVPVAYEVLDNWK 126 foxtail millet
ERN11155      41 IKRSK----YPQNVDLP-PILPKNKKKPYPIPLKTIQRAARADKKLAEKGIEKHLE-PPKNGLLVPDLIPVAHEVLEAWK 114 Amborella trich...
Q9FH50        34 SVDNDe---DPLYADVPkPPKDKSERKPYPTPMKELIRRAKEEKQLRKLQPCRVLEdPPDNGLLVPELVDVAHCVHRCRN 110 thale cress
XP_015625117  82 IITNE----HVQNADFP-PNYSKREKKPFPIPVLELRRRAKERAKKAEGKPKRSLP-PPKNGMLIKRLIPVAYKVYNARI 155 Japanese rice
XP_018683981  84 VVRSN----HPQNADLP-RYYSKREKKPFPIPILELRRTARERLKNAKKLPRKPTP-PPRNGMLVQSLIPVAYEVMNARI 157 wild Malaysian ...
Q8W4A5        72 VVRND----RPQNEDLP-KQYTRREKKPFPVPIVDLRRAARERVKNNKDKPKRPLP-PPKNGMVVKSLVPLAYKVYNARI 145 thale cress
XP_002275774 112 VIQSN----YPQNADLP-RYYSKKEKKPFPIPIVELRRAARERLKNMKGQPRRPIP-PPKSGLLVKRLIPVAYDVMNART 185 wine grape
XP_006587114  72 TIRNE----VPQNADFP-RQYSRKEKKPFPVPIVELRRAARERMKKMKDEPRKPMS-APKNGLLVKSLIPTAYNVYNARI 145 soybean
CBI16741      74 KKQIA----YPQNVDLP-PILPKKKKKPYPIPLKKIRQAARDDKKLAQKGIEKPLE-PPKNGLIVPDLVPVAYEVLDAWK 147 wine grape
KRH09242      69 WRRKT----LPQNEDLP-PILPKNKKKPYPIPFKEIKQAGREDRKLAHMGIEKPLE-PPKNGLLVPDLVPVAYEVFDAWK 142 soybean
XP_006358862  70 KKREA----VQQNVDLP-LVLPKQKKKPYPIPLKKIQQAAKADKKLAEVGIEKKLE-PPKNGLLVPSLVPAAYELLDDWK 143 potato
Q9XIR4        65 KKRYV----STQNVDLP-PILPKNKKKPYPIPFKQIQEEARKDKKLAQMGIEKQLD-PPKNGLLVPNLVPVADQVIDNWK 138 thale cress
XP_004976806 127 VLIRGLSQLLNVVTVYGCRKCPQVHVGPVGHQIQDCYGSGSQRRNSHHSWASGSINDVLIPIESYHLFDP-FGRRVKHET 205 foxtail millet
ERN11155     115 RLIKGLAQLIDIVPVYGCSHCTEVHVGPVGHLIQNCLGPSNVNRRSLHEWVRGSIDDVLNPTESYHLFDP-FGHRVKHDT 193 Amborella trich...
Q9FH50       111 MLLSGLSKIIHHVPVHRCRLCAEVHIGKQGHEIRTCTGPGSGSRSATHVWKRGRVSDVVLFPKCFHLYDRaVKPRVIHDE 190 thale cress
XP_015625117 156 LLINNLKRLMKVIPVKGCKHCSEIHVGSVGHPFRTCKGMSSDKRRGQHDWGGTLVEAVFVPVEAYHLEDR-LGKRIPHDQ 234 Japanese rice
XP_018683981 158 LLTNNLKRLMKVIPVLACKYCNEIHVGATGHPFKTCRGLRADHRKGLHEWITATVEDVLTPIETFHLSDR-LGKRISHEE 236 wild Malaysian ...
Q8W4A5       146 RLINNLHRLMKVVRVNACGWCNEIHVGPYGHPFKSCKGPNTSQRKGLHEWTNSVIEDVIVPLEAYHLFDR-LGKRIRHDE 224 thale cress
XP_002275774 186 TLINNLKKLLKVLPVHACKWCNEIHVGHVGHPFKSCRGPQTSIRKGDHEWTNAFIEDILVPVDAFHLFDR-LGRRIPHEE 264 wine grape
XP_006587114 146 TLINNLKKLLKVVPVHACGWCSEIHVGPVGHPFKSCKGTQANIRKGLHEWTNAHVEDILIPIEAYHLFDR-LGKRITHEE 224 soybean
CBI16741     148 VLIKGLAQLLHVIPVHGCSECSEIHVAQSGHHIQDCTGPSSVKRRGLHSWVKGSINDVLIPIESYHLYDP-FGRRIKHET 226 wine grape
KRH09242     143 LLIEGLAQLLHVIPAHGCSECSEVHVAQTGHHIRDCSGTNGRQRRSSHAWVKGSVNDILVPIESYHLFDP-FGRRIKHDT 221 soybean
XP_006358862 144 LFIKGLAQLLHFIPVHACSECSQIHVAQSGHEIQDCLGPTNSSRRSFHSWVTGSINDVLIPIESYHMYDP-FGTRIKHET 222 potato
Q9XIR4       139 LLIKGLAQLLHVVPVFACSECGAVHVANVGHNIRDCNGPTNSQRRGSHSWVKGTINDVLIPVESYHMYDP-FGRRIKHET 217 thale cress
XP_004976806 206 RFDYDRIPAIVELCIQAGVDLPQYPSRRRTSPVRMIGKK-VI 246 foxtail millet
ERN11155     194 RFRYDRIPAVVELCIQAGVDLPLYPSRRRLVPIRMLGKK-VI 234 Amborella trichopoda
Q9FH50       191 RFTVPKISAVLELCIQAGVDLEKFPSKRRSKPVYSIEGR-IV 231 thale cress
XP_015625117 235 RFAVPRIPALVELCIQAGVNLPEYPTKRRRKPIIKIGKNeFV 276 Japanese rice
XP_018683981 237 RFSIPRIPAVVELCVQAGVDLPDFPIKRRRKPVIRLGRSeII 278 wild Malaysian banana
Q8W4A5       225 RFSIPRVPAVVELCIQGGVEIPEFPAKRRRKPIIRIGKSeFV 266 thale cress
XP_002275774 265 RFSIPRIPAVVELCIQAGVDLPEFPTKRRRKPIIRIGKSeFI 306 wine grape
XP_006587114 225 RFSIPRIPAVVELCIQAGVEIPEFPTKRRRKPIIRIGRKeFI 266 soybean
CBI16741     227 RFSYDRIPAVVELCVQAGVDLPEYPSRRRTIPIRMIGKK-VI 267 wine grape
KRH09242     222 RFEYDRIPAVVELCIQAGVDIPEYPSRRRTNPIRMLGRR-VI 262 soybean
XP_006358862 223 RFNYDRIPAVVELCIQAGVDLPGYPSRRRTKPIRMMGKK-VI 263 potato
Q9XIR4       218 RFEYERIPALVELCIQAGVEIPEYPCRRRTQPIRMMGKR-VI 258 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap