Conserved Protein Domain Family
AvrRpt-cleavage

?
pfam05627: AvrRpt-cleavage 
Cleavage site for pathogenic type III effector avirulence factor Avr
This domain is conserved in small families of otherwise unrelated proteins in both mono-cots and di-cots, suggesting that it has a conserved, plant-specific function. It is found both in the plant RIN4 (resistance R membrane-bound host-target protein) where it appears to contribute to the binding of the protein to both RCS (AvrRpt2 auto-cleavage site) and AvrB, the virulence factor from the infecting bacterium. The cleavage site for the AvrRpt2 avirulence protein would appear to be the sequence motifs VPQFGDW and LPKFGEW, both of which are highly conserved within the domain.
Statistics
?
PSSM-Id: 398967
Aligned: 17 rows
Threshold Bit Score: 56.2427
Threshold Setting Gi: 223539081
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_008678137  80 AQGSSVPTWGQWNESNSgAGAHQYTLFFDQLREERKS 116 Zea mays
RID72077     138 EKVTVVPKFGDWDENNP-ASADGYTHIFNKVREERST 173 field mustard
XP_006340018 190 DRGAAVPRFGEWDENDP-QSADNYTHIFNKVREEKQG 225 potato
KRH07458     175 DKGAAVPKFGDWDVNNP-ASADGFTHIFNKVREERQG 210 soybean
XP_004252989 241 DDSPAVPKFGDWDENDP-ASAEGYTQIFNKVREEKQT 276 tomato
ERM97944     151 DKGTAVPKFGEWDESDP-ASADNFTQIFNIVRKEKHT 186 Amborella trichopoda
XP_003572426 172 TRGSAVPKFGDWD-SNP-ASADGYTHIFNKVREEKQT 206 stiff brome
XP_006652201 161 EDDVAVPPFGEWDESNA-ASGEKFTGIFNRVRDDKLS 196 malo sina
XP_009413300 145 QRATAVPKFGEWDATDP-KFTPGYTVIFNQVKEDKKA 180 wild Malaysian banana
XP_002884074   5 EAGRALPKFGEWDVNDP-ATADGFTVIFSKAGEDKKT 40  Arabidopsis lyrata subsp. lyrata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap