Conserved Protein Domain Family
DUF790

?
pfam05626: DUF790 
Protein of unknown function (DUF790)
This family consists of several hypothetical archaeal proteins of unknown function.
Statistics
?
PSSM-Id: 398966
Aligned: 72 rows
Threshold Bit Score: 344.528
Threshold Setting Gi: 530554570
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q18I74          1 MLTADLARSRT-DENSITPLLIDtdeQQYRETAAELIQIFEEHLGESRGELEDTIDQLTVSDTDYKIVQGLAKLLKDECE 79  Haloquadratum ...
Q9HJF2          1 MFPAELMVVRKaQDGTIRPLMIA---PDHVDIAEKVIEIYRSSAGRTRKEISKDIVTIEYgikNPKIVRGLALIMDRMST 77  Thermoplasma a...
ERJ07678        1 MLSKDLLRVSR-AGGGYQPQFVG---DDQRDLAARVIGVFQGHVGERREDLTAALTDVERAADDFKLVRGFAKLLERDAT 76  Halorhabdus ti...
CCQ37451        1 MLTKDLLRVSR-AGGGYRPRFTA---PADEALAARVLGVYQGHVGERRRDLDSALAELERAADDFKLVRGFAKLLEREAT 76  Natronomonas m...
WP_011323740    1 MLTKELLRVSR-AGGGYHPQFTT---AADEDVAARVLGVYQGHVGEPRAQLESALTDLERETGQFKLVRGFAKLLEREAA 76  Natronomonas p...
WP_014051090    1 MLRKEHLRVSR-AGGGYHLQFTD---ECHRSLAASLLGVFQGHIGERRAVLERALTEAEREAESFKLVRGLAALLEREAT 76  halophilic arc...
ELY29736        1 MLTKDLRRVSR-AGGGYHPQFVG---RESRPLAARVIGVFQGHVGEPRHRLDDALSSLEDEADDFKLVRGLAALLDREAT 76  Halogeometricu...
WP_009762000    1 MLTKDLLRVSR-AGGGYQPQFAG---ADSEALAASVLGTFQGHVGEERGVLRDALADLEADAEDFKLVRGLAHLVERDAT 76  Halobacterium ...
ADD04247        1 MLTKDLLRVSR-AGGGFHPQFAA---REHRPLAARVIGTYQGHVGQQRGDLEDALTDLERDADDFKLVRGLSALLEREST 76  Natrialba maga...
jgi:Htur_2025   1 MLTKDLLRVSR-AGGGYHLQFAD---REHRPLAARVIGTYQGHVGESRAELEAAVTELERGADDFKLVRGLSALLERDAT 76  Haloterrigena ...
Q18I74         80 FETVAPVDSREIRQELFEVANRNhpivrqptLGEDTQ-SVWIYSTVADRL--GISLEECYRGMYADLEENKRLVRFghrv 156 Haloquadratum ...
Q9HJF2         78 FRNRSRVDSKQLRGFLFQMGP----------AVSPEE-RQEKIALAAEHF--SVSPQDIEEAIYGDMDSENVLDQC---- 140 Thermoplasma a...
ERJ07678       77 FETRAPLPPARTRRAAFEAAESVg-------VVTEDE-RKQALGQAADRL--GSDRAAVESSLYADLEARQILAEId--- 143 Halorhabdus ti...
CCQ37451       77 FEVRSPLDPRRARTAAFEAAESVg-------VVSEAE-REAALAAAAERT--GATPDSVEASLFADRDVEAVLAAVe--- 143 Natronomonas m...
WP_011323740   77 FETRSPVSPRRARTAAFVAAESVg-------VVTEAD-RDAALVAAADDL--DTSADALAASLFADRDCEQRLTAFd--- 143 Natronomonas p...
WP_014051090   77 FEIQAAVPPRRARRVAFESAEAVs-------VVTAEE-RTEALSRAGDRL--GVDPGTVEQSLYADREPNQILASFe--- 143 halophilic arc...
ELY29736       77 FEVVAPLPPTRVRRATFEEAETAg-------VPTTTEaRTAVLKRVADRL--GTDTEAIEESLYADRAVNEVLTEFd--- 144 Halogeometricu...
WP_009762000   77 FAVEAPLDPESARRAAFTAAEDVg-------VVTADE-REAALAAAAERFpgDPTPDALAESLYADRETREVLVEVa--- 145 Halobacterium ...
ADD04247       77 FETDAEIDPERARRAVFEAADAVg-------VVTDDE-RTMALIRAGESL--GVSADELESTLYADLDERQVLTEVt--- 143 Natrialba maga...
jgi:Htur_2025  77 FETDAEIDPERARRAAFEAAEAVg-------VVTEDE-RAMALVRAGESL--GVSADDVAGALYADLEERQVLIELa--- 143 Haloterrigena ...
Q18I74        157 sdkyegadesstttrltgdseesyaeDTITVDWLLTRYNLALAQAELYDATEMWIRVWDSFATVFSYVKLFGLMHRIYPI 236 Haloquadratum ...
Q9HJF2        141 --------------------------PSITPEHLNRRYNLEQLTTLMYRSKFIEVSGINNWYRFISLIKRQGLVFEAQGN 194 Thermoplasma a...
ERJ07678      144 --------------------------RGWTPTTLLEQYNLSLAGTALFDATAVRIRSSDp-KALVSAVKRFGLLYEVDRT 196 Halorhabdus ti...
CCQ37451      144 --------------------------TDYGPGSLCEQYDLSLAQTALFDATAVRIRTSDp-KALVSALKRLRLLYEIRRT 196 Natronomonas m...
WP_011323740  144 --------------------------VDYDPESLCTQYDLSLAQTALFDATSVRVRTDDp-KRLVSAVKRLRLLYEIRRA 196 Natronomonas p...
WP_014051090  144 --------------------------PRWGPAELLEQYDLSLAQTALFDATEVRVRCAEp-ATLVSAVKRLGLMYELRQT 196 halophilic arc...
ELY29736      145 --------------------------ARWSPDSLLEQYNLSLAQTALFDATEVRVRSSDp-KRLVSAVKRLGLMYEIRRD 197 Halogeometricu...
WP_009762000  146 --------------------------PRWSPAELVAQYNLSLAQTALFDATEVRVESTDp-RSLVSAVKRLGLLYEVIPT 198 Halobacterium ...
ADD04247      144 --------------------------SRWDPDDLLAQYNLSLAQTALFDATELRVRSSDp-KALVSAIKRLRLMYEIRNP 196 Natrialba maga...
jgi:Htur_2025 144 --------------------------SRWEPDELVAQYNLSLAQTALFDATELRVRSSDp-KALVSAIKRLRLMYEIRRL 196 Haloterrigena ...
Q18I74        237 DSDgnrvpstdvadGYEAILDGAASLFSKSRKYGIRMANFLPALPLCDRWEMEADILDDEsgsagRTLSFELDSsS-GLS 315 Haloquadratum ...
Q9HJF2        195 PL-------------MSVRIDGPNSVFNNMERYGSSMARVVERLTAFPGWKLHAEVEIKD-----RVYSVDLDSsIsYYL 256 Thermoplasma a...
ERJ07678      197 Dd-----------gTRELHVTGPDALFESTRRYGTQFARLLRSVAKTAEWRLEATIDDDG-----RERTMTLTDaD-VSV 259 Halorhabdus ti...
CCQ37451      197 Ds------------GRVVIVTGPDALFTRSRRYGTRFARLLRTVTKAAEWDLKATIDDRG-----TERSLELDGtD-LRP 258 Natronomonas m...
WP_011323740  197 Da------------GRDVVVTGPDALFKRSRRYGTRFARLLRTVAATADWQLEATIDDRG-----TERRLRLEAgD-IEV 258 Natronomonas p...
WP_014051090  197 Da------------GRELVVTGPDSLFRSTRRYGTAFARLLRTVAKTTEWRLSATIDDRG-----RERELVLTEeD-ISV 258 halophilic arc...
ELY29736      198 Ge------------TRELVVTGPDALFRRTRRYGTAFARLLRTVAGTAEWTMTATIDDRG-----TEREMTLSDaD-LSV 259 Halogeometricu...
WP_009762000  199 De------------GRKVVLTGPDALFHNTRRYGTRFARVLRAVATADEWRLEATIDDRG-----TERLLVLTGeD-VSV 260 Halobacterium ...
ADD04247      197 Daaagst--gslasDREVVVTGPTHLFRATRRYGTRFARLLRTVAGAEAWHLEATIDDRG-----TERTLSLSHeDpVSV 269 Natrialba maga...
jgi:Htur_2025 197 ENDevgeapdrgiaEREVIVTGPTHLFRATRRYGTRFARLLRTVAKAEEWRLEATIDDRG-----TERTLRLSHeDpVRV 271 Haloterrigena ...
Q18I74        316 SHYSAQGE--FDSDVERTLAQKWERMNTDWKLVREDDVLDLGAEVMLPDFAIE-----------------HPDGRRVVFE 376 Haloquadratum ...
Q9HJF2        257 P----------ETDIEEE--------------EAIPDPVVIGTRVFFPTRII------------------NVHGQDVYVD 294 Thermoplasma a...
ERJ07678      260 PDIDPVVEptYDSDVEADFATRFGSLDLPWELLREPEALEAGASVAIPDFAFEy----------------RHGDFRVFFE 323 Halorhabdus ti...
CCQ37451      259 PDTDPVAEptFDSGVESDFYARFDALDLDWRLLREPEPLASGEHVVIPDFAFEw----------------RYGGFRVFFE 322 Natronomonas m...
WP_011323740  259 PDTDPVAEptFDSAVEADFYSRFSSLDLDWRLLREPEPLAAGEHVVIPDFAFEw----------------KHGDFRVFFE 322 Natronomonas p...
WP_014051090  259 PGVEPVAEptYDSAVEAKFAASFQSLDTDWNLVREPEPLETGTRVMIPDFAFDyapag-------adaqsVADRFRVYFE 331 halophilic arc...
ELY29736      260 PNVEPVTEptYDSGVEADFAARFEGLDLDWELVREPEPLAAGARAMIPDFAFVyrpggda----agensgDDPEFRVFFE 335 Halogeometricu...
WP_009762000  261 PDADPVAEvsFDSDVEREFATRFDSLDLDWTLVREPDVLAAGDRLMVPDFAFEy----------------DYGDARVYFE 324 Halobacterium ...
ADD04247      270 PDAEPVADvtFDSGVESDFAARFTQLDLDWDLVREPEPLATGTQVMIPDFTFEy----------------AHGEYRLYFE 333 Natrialba maga...
jgi:Htur_2025 272 PDAEPVAEvsFDSGVEADFAARFSTLDLEWDLVREPAPLATGTRVMIPDFAFDyrpggsarrdssdesdgGHSEFRVYFE 351 Haloterrigena ...
Q18I74        377 IVGFWTPEYLDKKLAKIRDA-DRDNLIVAVSERLDCSSDdFEGMDDRVLWFKSGIHVYDVVELA 439 Haloquadratum walsbyi DSM 16790
Q9HJF2        295 IVYHMSPEAIKRRDEMIRSSg--IKWITAVVGECKKFQG--------VLCFRNRVDWDAIIAKA 348 Thermoplasma acidophilum
ERJ07678      324 IMGFWTPEYVEKKLAQFDAI-EDVELLVAYDESLGVGEA-IEARDHRAIPYTGSVRVKDVRDAL 385 Halorhabdus tiamatea SARL4B
CCQ37451      323 IMGFWTPEYVEKKLSRFADL-EDVAFLVAYDESLGVGEA-IEATGQRAISYSGTVRLADVRDAL 384 Natronomonas moolapensis 8.8.11
WP_011323740  323 IMGFWTPEYVEKKLSRFSDL-EDVAFLVAYDESLGVGED-IEATGQRAFPYTKTVRLKDVRDAL 384 Natronomonas pharaonis
WP_014051090  332 IAGFWTPEYIEKKLSQLANV-EDVALLVAVDESLAASEE-IEARGHRAIPYSGSVRVKDVVDAL 393 halophilic archaeon DL31
ELY29736      336 VMGFWTPEYVEKKLDQFATVsDDVELVVAADESLAVAED-VAELDHRVVTYSGSVHVKDVVDLL 398 Halogeometricum borinquense DS...
WP_009762000  325 IMGFWTPEYVEKKLAQLEDT--DETLLVAVDASLGVGEE-IAARDHRVVEYTGSVRVKDVVDAL 385 Halobacterium sp. DL1
ADD04247      334 IMGFWTPEYVRKKLDQLESL-EDVDLLVAVDDSLGVGEA-IETRDHRAIPYSGTVRVKDVVDVL 395 Natrialba magadii ATCC 43099
jgi:Htur_2025 352 IMGFWTPEYVEKKLAQLSDL-EDVELIVAVDESLGVGEE-IAARDFRAIPYSGSVRLKDVAGVL 413 Haloterrigena turkmenica DSM 5511
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap