Conserved Protein Domain Family
LSR

?
pfam05624: LSR 
Lipolysis stimulated receptor (LSR)
The lipolysis-stimulated receptor (LSR) is a lipoprotein receptor primarily expressed in the liver and activated by free fatty acids. It is thought to be involved in the clearance of triglyceride-rich lipoproteins, and has been shown in mice to be critical for liver and embryonic development.
Statistics
?
PSSM-Id: 398964
Aligned: 11 rows
Threshold Bit Score: 1e+06
Threshold Setting Gi: 301623330
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002940967 162 HWLTVLFIVLGGLLLFLLIGICWCQCCPHCCCCYVRCPCCPTKCCCPE 209 tropical clawed frog
XP_023270353 163 HWLTVLLIVIGAILLIILFGICCCQCCPQKCCCYVRCPCCPQQCCCPE 210 Seriola lalandi dorsalis
Q8CBR1       166 HWLTVIFIILGALLLLLLIGVCWCQCCPQYCCCYIRCPCCPTRCCCPE 213 house mouse
XP_027305396 214 HWLTVLLIVLGGLILLSLIGICWCQCCPQYCCCHIRCVCCPTRCCCNE 261 mallard
XP_008106077 163 NWLTVILIIIGGLLLLLLIGICWCQCCPQHCCCHVRCPCCPTRCCCNE 210 green anole
ELV09355     211 DWLFVVVVCLAGFLFFLLLGICWCQCCPHTCCCYVRCPCCPDKCCCPE 258 Chinese tree shrew
KTF78774      33 DWLLVVLVVLGFLLLLLLIGICWCQCCPHTCCCYVRCPCCPERCCCPR 80  common carp
XP_010125041  31 EWVFVGLVILGAFLFFLLVGICWCQCCPHSCCCYVRCPCCPESCCCPR 78  Macqueen's bustard
XP_005167905 185 EWAFVGVVVVGSILFLLLVGICWCQCCPHSCCCYVRCCCCPDTCCCPK 232 zebrafish
XP_018539204 226 EWVFVSAVALGSVLFLLLVGVCWCQCCPHSCCCYVSCWCCPDTCCCPR 273 barramundi perch
XP_028921079 217 DWLFVVVVVLAALLVIILLGVCWCQCCPHSCCCYVRCPCCPQRCCCPE 264 platypus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap