Conserved Protein Domain Family
HOOK

?
pfam05622: HOOK 
HOOK protein
This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms. The different members of the human gene family are HOOK1, HOOK2 and HOOK3. Different domains have been identified in the three human HOOK proteins, and it was demonstrated that the highly conserved NH2-domain mediates attachment to microtubules, whereas the central coiled-coil motif mediates homodimerization and the more divergent C-terminal domains are involved in binding to specific organelles (organelle-binding domains). It has been demonstrated that endogenous HOOK3 binds to Golgi membranes, whereas both HOOK1 and HOOK2 are localized to discrete but unidentified cellular structures. In mice the Hook1 gene is predominantly expressed in the testis. Hook1 function is necessary for the correct positioning of microtubular structures within the haploid germ cell. Disruption of Hook1 function in mice causes abnormal sperm head shape and fragile attachment of the flagellum to the sperm head.
Statistics
?
PSSM-Id: 398962
Aligned: 20 rows
Threshold Bit Score: 512.683
Threshold Setting Gi: 251764697
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009247919 186 ELQEALAEKEELRQRCEELDMQVTTLQDEKNSLVSENEMMNEKLDQLDgsf-------ddPNTV--VAKKYFHAQLQLEQ 256 Sumatran orangutan
Q5TZ80       180 DLTEVMAEKEELAQRCQELDMQVTVLQEERNSLLAENDLLTDRSSQLEtf--------ddPSTP--SGRKHSQLQFQLEQ 249 zebrafish
XP_001145260 184 ELNEALSAKEEIAQRCHELDMQVAALQEEKSSLLAENQVLMERLNQSDsi--------edPNSP--AGRRHLQLQTQLEQ 253 chimpanzee
B6MFW3       176 ELNEVRAAKEEIAQRCHELDMQVQQLMEENTLMKVEKDELSDKVNQVDgy--------edTSTP--AGRRYIQLTHQVEQ 245 Florida lancelet
B4I5P7       181 DSKAVQEDRDALAQKCFETEKKMLLLIDEKTNLQQELHKLQQEFARLEqhstvigddgvsLGPVqtGSVRYNELRRQLDL 260 Drosophila sech...
Q7PWT9       175 DVKTLQEDRDTLAQKCHETNKKMLGLIEEKAALQQEIVKLQAIVGRYEnpnlig-ddgtsLGPIqlGSSRYNDLRKLVDS 253 African malaria...
Q17AF4       173 DVKTLQEDRDSLAQKCHETNKKMLILIEEKSVLQQEITKLQALIARYEnpnlig-ddgtsLGPVqlGSTRYNDLRKVVDS 251 yellow fever mo...
XP_395724    183 ELQVTVDMKEQLAQKCHELDQQLSLLQEEKAALMTENKKLQERLDEFEnp---------eSCSI----FRHSGLRKQVEA 249 honey bee
EFN89605     186 ELQTAVDMKDQLAQRCHELDQQLSLLQEEKAALIVENKKLQERLDEFEnp--------eeSGSI----LKYSGLRKQAEA 253 Jerdon's jumpin...
EFN60607     183 ELQVAIDMKDQLAQKCHELDQQLSLLQEEKAALIAENKKFQERLDEFEnp--------eeSGSI----MKYSGLRKQVDA 250 Florida carpent...
XP_009247919 257 LQEENFRLEAAKDDYRVHCEELEKQLIEFQHRNDELTSLAEETRALKDEIDVLRATSDKANKLESTVEIYRQKLQDLNDL 336 Sumatran orangutan
Q5TZ80       250 LQEENFRLEAAKDDYRIHCEELEKQLVELQHRNDELTSLAEESRSLKDELDILRSCSDRAVKLEASVETYRKKLEDLSDL 329 zebrafish
XP_001145260 254 LQEETFRLEAAKDDYRIRCEELEKEISELRQQNDELTTLADEAQSLKDEIDVLRHSSDKVSKLEGQVESYKKKLEDLGDL 333 chimpanzee
B6MFW3       246 LQEETYRLETGRDEYRLKCEEMEKEILDLAGKNEELMALAAETQLLKDEMDILRQSAEKTSKYEQTIETYKKKLEDLADL 325 Florida lancelet
B4I5P7       261 LKEELLQSEGAREDLKIKAQQQDTDLLHMQMRIEELMKSSAEVTTLKDEVDVLRESNDKLKICEAQLDTYKKKLEDYNDL 340 Drosophila sech...
Q7PWT9       254 LKDELLQAETARDDLKMKSMIQEKEIGELQVKIDELHAATAEIAQLKDEIDILKEANEKLKICETQLQTYKKKLEDYNDL 333 African malaria...
Q17AF4       252 LKDELLQAETARDDLKMKSAMQEKEIADLQVKIDELHTATAEIAQLKDEIDILKEANDKLKMCETQLLTYKKKLEDYNDL 331 yellow fever mo...
XP_395724    250 LKDELFKVETSRDDYRLKIELLEKEVLELQSRQEDLQKAADEANNLKDEIDALRETADKVAKYEQTIESYKKKMEDLSDL 329 honey bee
EFN89605     254 LKDELFKVETSRDDYRLKVELLEKEVLELQLRQEDLQKAADEANHLKDEVDALRETVDKVAKYELTIESYKKKMEDMGDL 333 Jerdon's jumpin...
EFN60607     251 LKDELFKMETSRDDYRLKAELLEKEVLELQSRQEDLQKAADEANHLKDEIDALRETADKVAKYEIMIESYKKKMEDLSDL 330 Florida carpent...
XP_009247919 337 RKQVKTLQETNMMYMHNTVSLEEELKKANAARTQLETYKRQVQDLHVKLSSESKRADTLAFEMKRLEEKHEALLKEKERL 416 Sumatran orangutan
Q5TZ80       330 RRQMKALEEKNMTYMHNTVSLEEELRKANAARAQLETYKRQVQELHKKLSDESRRADNLVFEMKKLQEKYDALVKERERI 409 zebrafish
XP_001145260 334 RRQVKLLEEKNTMYMQNTVSLEEELRKANAARSQLETYKRQVVELQNRLSEESKKADKLDFEYKRLKEKVDSLQKEKDRL 413 chimpanzee
B6MFW3       326 RRTVEQLQEET--YRLETGLSHCELRKANTLRSQLDMYKKQVQELHGKVSEETKRADKAEFELKRSTEKLDTVQKEKQRI 403 Florida lancelet
B4I5P7       341 KKQVKILEERSADYVQQNAQFEEDAKRYANTKGQVELFKKEIQDLHAKLDAESSKNVKLEFDNKNLEGKNLALQRAKDSL 420 Drosophila sech...
Q7PWT9       334 KKQIKLQEERSADYLKQNLEYEEEAKKYAGLKGQVELYKKKIQDLHGMLDEEMGKTVRAEFEYNQLQGQLAVVQREKETL 413 African malaria...
Q17AF4       332 KKQIKMLEECSAEYLKQNLQHEEEAKKYSGLKGQVELYKKEIQDLHAKLDSEMSKTVKTEFEYNQLQAKLSAVQREKENL 411 yellow fever mo...
XP_395724    330 RRQVKILEDKNLEYLQSKIDYEEESKRTTMLRNHLEVCKQQLAEAHHKLDEQTNKCDKLEFEGKKMEAQLSTLQRERDRL 409 honey bee
EFN89605     334 KRQMKILEDKNLEYLQVKLDYEEESKRTTMLRNHLEICKQQLTETQHKLDEMSGKYDRLVCEDKKKEARMNTLQRERDRL 413 Jerdon's jumpin...
EFN60607     331 KRQLKISEDKNVEYLQAKLDYEEEVKRTMMLRNHLEACKQQLTEVHHRLDEQSNKYDRLEFEGKKMEAKLGALQRERDRL 410 Florida carpent...
XP_009247919 417 IEQRDTLKETNEELRC-SQVQQDH--LNQTD--ASATKSY----ENLAAEIMPVEYREVFIRLQHENKMLrLQQEGSENE 487 Sumatran orangutan
Q5TZ80       410 SIERDTLRETNEELRC-TQAQQDQ--LLLAGkyQTGSPSH----DNLAAEMLPIEYREKFIRLQHENKMLrLQQEESEKQ 482 zebrafish
XP_001145260 414 RTERDSLKETIEELRC-VQAQEGQ--LTTQGlmPLGSQESs---DSLAAEIVTPEIREKLIRLQHENKMLkLNQEGSDNE 487 chimpanzee
B6MFW3       404 VNERDTLKETNEELHC-MQLQQGKamLYSTGslAGIGSNVespvGSPIPEVVPPEIKEKLIRLQHENKMLkLKAEGSDDE 482 Florida lancelet
B4I5P7       421 LKERDNLREAVDELKC-GQLSSNTal----------------tgTTVSRELQPSATVEKLQRLEAENKALrEGQGGQ--- 480 Drosophila sech...
Q7PWT9       414 LSERDTLREALDELKC-GQAVGAD-----------GVGHGgpggNTMSKELHSNDVCERIERLERENKALrEGQGGQ--- 478 African malaria...
Q17AF4       412 LSERDVLRETCDELKC-GQAAEDSes-----------------gNTMSKELHSSDVRDRIERLERENKVLrEGQGGQ--- 470 yellow fever mo...
XP_395724    410 IVERDALKETNEELKC-TQLQAAE---------NITKPSTd---tVTNTEMIPLEIKEELLCLKHENKMLkLKQMGN-ED 475 honey bee
EFN89605     414 VIERDALRETNEELKC-AQLQAAE---------NMAKPSTvdsnSVAGTEMIPLEVKEKLLCLQLENKMLkARQKGN-EE 482 Jerdon's jumpin...
EFN60607     411 VIERDALKETNEELKCnTQLQTAE---------NMAKPSAds-sGVAGTEMVPLEIKEKLLRLQLENKMLkMKQTGN-ED 479 Florida carpent...
XP_009247919 488 RIEELQEQLEQKHRKMNELETEQRLSKERIRELQQQIEDLQKSLQEQGSKSEGesSSKLKQKLEAHMEKLTEVHEELQKK 567 Sumatran orangutan
Q5TZ80       483 RITELQQQLEEARRGRSQLDTDNRLNRERISELQQQVEDLQKALQTQGAKPDD---SHLKRKLDAHMVQLNEAQDEIMKK 559 zebrafish
XP_001145260 488 KIALLQSLLDDANLRKNELETENRLVNQRLLEVQSQVEELQKSLQDQGSKAED--SVLLKKKLEEHLEKLHEANNELQKK 565 chimpanzee
B6MFW3       483 RLAVSQAMLDDAQARTNELETENRLANQRILELQGQLEDMQTEQEEVGSPAKDqdSVALRKKLEEHMEKLKDADSQLQKK 562 Florida lancelet
B4I5P7       481 --TALAQLLDDANKRCENLREQLKTANERILSLSHA------------SQSDD--PILKESEFGKQIKQLMELNEQ---K 541 Drosophila sech...
Q7PWT9       479 --TALSQLLDDANQRNEKLREQLKSANQKILLLSQH-------------HAED---GTTKSELEMQMKQTLELGEQRSSA 540 African malaria...
Q17AF4       471 --TALSQLLDDANQRNEKLRDQLKAANQRVLLLSQH-------------HNED---ISSKSDMDIQLKQALELNEQRSS- 531 yellow fever mo...
XP_395724    476 KLPTVQALLEDSEERLNTLRGKNRKANQRIIELENRLEEALGNQSSGDNKTDN---INLGQKITQLQDEVRKIQSEKERL 552 honey bee
EFN89605     483 KLPSVQTLLDESEERLNTLREQNRKANQKIMEMEAKLEEVTMQSSNADGKSDS---GGLGQKAVQLQDELRKAQAEKERL 559 Jerdon's jumpin...
EFN60607     480 KLPSVQALLDDSEERLNTLRGQNRKANQRIMELETKLEEVMGTQTSDDNKND----AGLNQKMSQLQDELRKMQAERERL 555 Florida carpent...
XP_009247919 568 QELIEDLQPDINQNV-QKINELEAALQKKDEDMKAMEERYKMYLEKARNVIKTLDPKLNPAS-AEIMLLRKQLAEKERRI 645 Sumatran orangutan
Q5TZ80       560 KELLEDLQPDATQTS-VKMDELMAALKKKDEDMRAMEDRYKMYLEKARDVIRALDPKLNPAS-AEIQSLKVQLSDKDKKI 637 zebrafish
XP_001145260 566 RAIIEDLEPRFNNSS-LKIEELQEALRKKEEEMKQMEERYKKYLEKAKSVIRTLDPKQNQGAaPEIQALKNQLQERDRLF 644 chimpanzee
B6MFW3       563 KEYIDNLEPKVSSSA-EKIQQLQEMLNKKDDDMKAMEERYKRYLEKAKSVIRTLDPKQNQSStPEVQALKNQLTEKERLI 641 Florida lancelet
B4I5P7       542 TLQLEE-AVTQSTSLqCKVTQLETNLSAREQEILVYDAKYRKCVEKAKEVIKSIDPRI-------ASALDASVLE--KSA 611 Drosophila sech...
Q7PWT9       541 QQQLDETTQHQLSNLhTKIANLEAALVVKDQELQAADVRYKKCVEKAKEVIKTLDAHAi----SEALLM--------DKV 608 African malaria...
Q17AF4       532 --QIDE-AQSQMTQLhTKIANLEAALAAKDQELLAADSRYKKCVEKAKEVIKTLDPRAi----NEALLLEKPSQDGEASS 604 yellow fever mo...
XP_395724    553 ILQVEERENALQTQK-QKVFALQEKLTRREYDNAALEERYKKYVEKAKSVIKSLDPKQNNSSpNEVAVLRNQILEQRKIM 631 honey bee
EFN89605     560 TLQLEEREATLQVQK-QKTATLQEKLTRKEYEDAAREEHYKKNVEKAKSVIKSLESSK--HSpTEL-VLRNQLLEQRKAI 635 Jerdon's jumpin...
EFN60607     556 TLQLEERESALQAQK-QKAFAIQEKLTRKEYENAALEERYKKYIEKAKSVIKSLDPKQNNSSpSEVVVLRNQLLEQRKMI 634 Florida carpent...
XP_009247919 646 EILESE-CKVAKF-------------RDYEEKLIVSAWYNKSLAFQKLGMESRLVSGGgacsdtgactPARSFLAQQRHI 711 Sumatran orangutan
Q5TZ80       638 IALERE-CEQAKL-------------REYEEKLIVTAWYNKSLNFQKMAIESRLSGRAnsl-----vpPGQSFLAQQRQV 698 zebrafish
XP_001145260 645 HSLEKE-YEKTKSq------------REMEEKYIVSAWYNMGMTLHKKAAEDRLASTG----------SGQSFLARQRQA 701 chimpanzee
B6MFW3       642 DHLERD-HEKAKLt------------REQEEKLIVSAWYNMGAQLHRKAVEGRLANGGpm-------qGGQSFLARQRQA 701 Florida lancelet
B4I5P7       612 DLVEAEpKPKMSV---------------MEEQLMTSAFYRLGVNAQRDAIDSKLAILMg---------SGQTFLARQRQS 667 Drosophila sech...
Q7PWT9       609 DSASGTgVDATLTtvgnggtaarapmGQQEEQLIATAFYRLGMVCHREAVDARL--LSg---------PGQSFLARQRQP 677 African malaria...
Q17AF4       605 SSATGSgGDASTLtstgs---grvpmGVQEEQLIATAFYRLGMTCQREAVDSRLALLSg---------PGQSFLSRQRQP 672 yellow fever mo...
XP_395724    632 EDMERS-LKESKLi------------KEMEEKLMISAFYRLGLTCHREAIDQRLAALSs--------gQGQSFLARQRQP 690 honey bee
EFN89605     636 EEMERT-VKESRLl------------REMEEKLMVTAFYKLGLSAQRDAMDQRLATLSs--------gQGHSFLARQRQP 694 Jerdon's jumpin...
EFN60607     635 EDMERS-MKESRLl------------REMEEKLMVTAFHRLGLNCHREVIDQRLAALSs--------gQGQSFLARQRQP 693 Florida carpent...
XP_009247919 712 TNTRRNLS 719 Sumatran orangutan
Q5TZ80       699 TNARRTMS 706 zebrafish
XP_001145260 702 TSSRRSYP 709 chimpanzee
B6MFW3       702 TSRRTTVS 709 Florida lancelet
B4I5P7       668 AP-RKSLS 674 Drosophila sechellia
Q7PWT9       678 AA-RKPLN 684 African malaria mosquito
Q17AF4       673 AP-RKPMN 679 yellow fever mosquito
XP_395724    691 SA-RRHPP 697 honey bee
EFN89605     695 SA-RRHSP 701 Jerdon's jumping ant
EFN60607     694 SA-RRHPP 700 Florida carpenter ant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap