Conserved Protein Domain Family
TniB

?
pfam05621: TniB 
Bacterial TniB protein
This family consists of several bacterial TniB NTP-binding proteins. TniB is a probable ATP-binding protein which is involved in Tn5053 mercury resistance transposition.
Statistics
?
PSSM-Id: 398961
Aligned: 35 rows
Threshold Bit Score: 177.383
Threshold Setting Gi: 428690318
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_006460236   23 RIDY---MNNPLWINhNRSTQVIQLL-NQLLRNPKKPRMRNLLMIGEPNIGKTSLIKYYSNLH--PSY-TS--EDEDgis 93  Thiomicrospira...
WP_015460531   23 TAQRlnlIRQKVFIRyAAADAITERLqEALEDYPTEGD-SHILIWGPSGIGKSQIVKRFAKLQnlPDD-PR--ASKA--- 95  Proteobacteria
Q2N7S8         20 RLAY---LAEPDTIYhPRMMEIEDRL-RAILEAPEPHE-HSIAVFGRSYNGKSTISKHFASLY--PVQ-TGmmGDAD--- 88  Erythrobacter ...
Q21PC7         20 KLDW---VRSDFWVGyTRADEILGYL-EDLMQYPKSIRMPCALLVGEPGNGKSTIVEEFSARH--EVT-FK--ETGE--- 87  Saccharophagus...
WP_052473099   21 RIDF---INEDRWIGySAAATILTEF-DDLVEHPRNLRMPCRYVVGDPDNGKTMLLHQCIKRH--PFReKE--GDES--- 89  Sulfuritalea h...
jgi:Caul_5461  16 RIDT---VLSDRWVAyPQGQAALQRL-AELLRGAQRTRMPSLLIVGDPDMGKTTILRKFMRGR--SPT-FDpeTGRS--- 85  Caulobacter sp...
Q1QFA9         20 RIAH---LQAPRWIGtQAARDAIDLL-QAGLDRAPALRTRGVMLIGPYANGKSMIAERFAIMD--RRR-AD--AARN--- 87  Nitrobacter ha...
Q11MK9         20 RIAY---IQAPRWIGhHVAVQAHARL-AELLSRPPSLRTRGLMLVGPYANGKTMIAERFAVGH--LRT-V------E--- 83  Chelativorans ...
vbi:Arad_7802  20 KIAY---IQAPRWVGyPIAEAAHARL-AELLARPPGLRTHGLMIVGPYANGKTMLVERFAVDH--LKM-TP--LPQR--- 87  Agrobacterium ...
Q2W0R4         26 RIRR---IRSPRYVAyEAGEAILGRL-AWLYDHPKVVRPPCSLIYSDTNNGKTALAQKFVRDH--SPA-EDs-PDFG--- 94  Magnetospirill...
WP_006460236   94 raNI-PLIVIDAPTLESEKALFVSILEQFWTPf-NPEHTPL-RLRNQVISLMRECNVRMLIIDEFHNLLtfsaskrLKTI 170 Thiomicrospira...
WP_015460531   96 --NV-PVLVVSMGPTGSARGLLVRILGQLNAPy-GKSASTD-TLYPDVLRLLRTSGVKILVIDELHHIEkgnrkqrEEAL 170 Proteobacteria
Q2N7S8         89 --RA-DVVRVSMPGEASVREFAIRILRYVSEPf-NLRWSTS-HLTSMVYAVLRTMQTRLLLIDEFQDLAngthrnrEALK 163 Erythrobacter ...
Q21PC7         88 --PIkPVLVMDMPSRPKDSEFYSQILFALRVAh-KTSDGVE-SKKDQAHRMLLALQTRIVILDEFHDILhctsreqRAFL 163 Saccharophagus...
WP_052473099   90 --HV-AVLVFETPPVPDEGRLYSQILKALRVAh-REDAPPE-KLLAKVIERFSELGIRLLMADEFHNMLngsashqRQFL 164 Sulfuritalea h...
jgi:Caul_5461  86 --QM-EVVAIEAPPEADELRLYGAILDAIGAPv--PARRAM-EAERAVHGQLQRLRTRLLVIDETNNLMigtgaaqRKTL 159 Caulobacter sp...
Q1QFA9         88 --PR-RVVLVQTREGSGLVNFYAGILAALEAPqiKARDTSA-KADQLD-RLLRQLKPRVMIFDEFHNCLrgrrrdiEAIF 162 Nitrobacter ha...
Q11MK9         84 --QR-RVWVVQTREGAGLAHFYGSILQGLRAPt-GSSRDVGrKAEQV-DHLLDRLKPRVLIFDEFHNALrgrardvEAVL 158 Chelativorans ...
vbi:Arad_7802  88 --K---VWIVQTREGAGLVHFYGSILHALRAPi-CNNQSIGrKIEQID-RLFEHVKPKVLIFDEFHNALrgrsrdiEAIF 160 Agrobacterium ...
Q2W0R4         95 --KR-PVVYAHAPPYADISGLYDAILRSLGAPy-RSTARPQ-AKWDQLLQLLAAVGTRVLILDEVSNFLigkvdqrSMVL 169 Magnetospirill...
WP_006460236  171 GILKTLGNELMIPIVAVGIHDAMTLINSDPQIASRFDTLTIPRWDL 216 Thiomicrospira aerophila
WP_015460531  171 ATIKLLGNDLGITIVGCGTIAALRTLRWDPQIERRFEPHRLEVWGH 216 Proteobacteria
Q2N7S8        164 NMVKSIGEDCGCGVALFGTPPGVDILNDDPQLQRRFEQVVLPPWKR 209 Erythrobacter litoralis HTCC2594
Q21PC7        164 AVLKKLTNLLKIPIVGVGTREAITVFHTDTQLSSRFEAIGLSKWKL 209 Saccharophagus degradans 2-40
WP_052473099  165 ASLKSLINTLRVSFVAAGTEDITRALATDSQFITRFEKLALPTWGI 210 Sulfuritalea hydrogenivorans
jgi:Caul_5461 160 AALRRLSNMLSLSMAYFGTLEALNALTSDPQIEGRAQPFRLARLAK 205 Caulobacter sp. K31
Q1QFA9        163 AVLRRFGRDYDLSPALVGELSIFDHVMLTAEMASRFQLAPVPRWSY 208 Nitrobacter hamburgensis X14
Q11MK9        159 AFLRRIGRQFDISPVLIGEVAVFDFVNQTAEMATRFDLHAVPRWQY 204 Chelativorans sp. BNC1
vbi:Arad_7802 161 AFLRRIGRQYDISPVLVGEVSVFDCINTTSEMASRFELQAAPRWRY 206 Agrobacterium radiobacter K84
Q2W0R4        170 NSLKSLSNELKIPVVAMGTQDAVRVFQTDQQLGNRFEPIGIPRWSV 215 Magnetospirillum magneticum AMB-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap