Conserved Protein Domain Family
LAP1C

?
pfam05609: LAP1C 
Lamina-associated polypeptide 1C (LAP1C)
This family contains rat LAP1C proteins and several uncharacterized highly related sequences from both mice and humans. LAP1s (lamina-associated polypeptide 1s) are type 2 integral membrane proteins with a single membrane-spanning region of the inner nuclear membrane. LAP1s bind to both A- and B-type lamins and have a putative role in the membrane attachment and assembly of the nuclear lamina.
Statistics
?
PSSM-Id: 398955
Aligned: 26 rows
Threshold Bit Score: 569.33
Threshold Setting Gi: 611987911
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EHB02131      17 L------------ENDP----SVNSQ---------EQETTVTasSTEE--AQTPNPASGLSK---------------E-- 52  naked mole-rat
F1N4E5       153 Lrdsh-----sseEDEPps-qTVLSQtvtkkairrTQETPVM--SEDPliSLRRPPLRSSRS---------------E-- 207 cattle
XP_008541823 152 Lrdsh-----sseEDELfs-nTVLSQtgskkiiqrTQETPGMsdDPVK--SLCRPPIRSSGS---------------Dsa 208 Przewalski's horse
Q5JTV8       151 Lrdsh-----sseEDEAss-qTDLSQtiskktvrsIQEAPV---SEDLviRLRRPPLRYPRY---------------E-- 204 human
EHB02130     151 Lrdsl-----sseEDEPss-qTVTNQtvsk-ksvrTQEAPVT--SEDPviSLCRPPLRSTRS---------------E-- 204 naked mole-rat
Q5PQX1       150 Lrdaqsl-sedrgEDEPss-qPVTSQtvsk-ktvrTPETSVM--SEDPisNLCRPPLRSPRP---------------D-- 207 Norway rat
EGW10153     150 Lrds------qssEDEPsssqTVTSQtask-rtvrTPDASMM--SEDPisNLCRPPLRSPRS---------------Dst 205 Chinese hamster
XP_019656872 154 LrdspssegeaagEDEPss-qTILSQtipkktiqrAQETPVv--SEDPiiSLCRPPLRSSRSdsayktngntkmnelE-- 228 giant panda
XP_014311547 150 Lrdsh-----sseEEELsp-qTVVSQtvskktvrrTQETSVM--SGDSvlDLLRPPLRSPRS---------------Esa 206 little brown bat
XP_010589283 152 Lrnsy-----sseEDDPss-qTVLSQpvsk-ktvrTPEVPVV--SEDRvlSLCRPPLRNSRT---------------Dss 207 African savanna...
EHB02131      53 ----GPESADTGEKSERSDETNFGNyPkdKTEDENNLSFQDgeqkdhlpseNLGKEPLDPDANHSPSDKGRKADANLGSs 128 naked mole-rat
F1N4E5       208 -------------AASVQQKVNFLEeG--ETEENDQDSFDS----------DVT-VKVRSGDSVESGDQTTRSSSQYKEs 261 cattle
XP_008541823 209 yktnGNTKMNELDATSVQQKFSFSEeG--ETEDDDQDSYDS--------------VKIRYGDSVNFGGQTSRSSSQHSEs 272 Przewalski's horse
Q5JTV8       205 -------------ATSVQQKVNFSEeG--ETEEDDQDSSHS----------SVTTVKARSRDSDESGDKTTRSSSQYIEs 259 human
EHB02130     205 -------------ASSVKQKVNFSEeG--ETEDDDQDGSYS----------DTTTVKVRSGDSVEPGDQTTRSSSQCPEs 259 naked mole-rat
Q5PQX1       208 --------------ASIVQHINPFEeG--ETE-DDLESSYS----------DVT-IRIRSRDSVESRDEAAVAAGHHPDs 259 Norway rat
EGW10153     206 yktnGNSKMSEIEAVST-QPVHFSEeG--ETE-DDLESSYS----------DTT-VKVRSRNSVESRDEATRSSSYCQEs 270 Chinese hamster
XP_019656872 229 -------------ATGVQQKVNFSEgG--ETEQDDQDSSDS----------DITTAKVRSGDSLDFGDQTTRSSSQYPEs 283 giant panda
XP_014311547 207 yktngntemseleATSVPQKVNFSEeG--DTEEDDQDVSDS----------AVTSVKVRSGESLDSGDQTSRPG-QHLEs 273 little brown bat
XP_010589283 208 ystnGNSKMSELEATSVQQKGSFSEeG--ETEEDDSDSSES----------DVTVGKVRSGDSVDSGDQTIRSASRYPEs 275 African savanna...
EHB02131     129 saslpeeindrtkPSQEPSTadsqeaR------------SPSHSRRE----SQDSLRR-RWp-------------sPEAG 178 naked mole-rat
F1N4E5       262 fwqssq-sgdftaFDEQPLK------L------------SSGYQKTPqewaEKTVRIRtRMltsspgmrsiygsfsDDDS 322 cattle
XP_008541823 273 pwqsaq-nrdftaLDKQPSV------L------------SSGYQKTPqqrvEQTTRKRtWM---------------QNDS 318 Przewalski's horse
Q5JTV8       260 fwqssq-sqnftaHDKQPSV------L------------SSGYQKTPqewaPQTARIRtRM---------------QNDS 305 human
EHB02130     260 irrlpq-sqdstaHNKQSSV------L------------SSGYQKNPqewfEHQIRMRtRM---------------QSDS 305 naked mole-rat
Q5PQX1       260 lwglphsrgdftaHENQPSL------L------------PTGCQKNPqewvEQAVRMRtRM---------------AYNN 306 Norway rat
EGW10153     271 swrlpq-sqdftaHENQPSV------L------------NSRCQKNAqewvEQVIRMRtRL---------------LQNN 316 Chinese hamster
XP_019656872 284 fwqssq-srdfitLDKQPSV------L------------SSGYQKTPqewfEQPTRRRaRI---------------HNDN 329 giant panda
XP_014311547 274 fwqssq-sqdfkaLDKQHSV------PsskyqknlqnikISEHQKNLqervDQTTRRRtKMp---------------NDS 331 little brown bat
XP_010589283 276 fwqssqsrdfttaHDKQPSV------L------------SSGYQKNLqewvEQTPRIRsRM---------------QNDN 322 African savanna...
EHB02131     179 SHEQETQTLGEKKE-IAQ--DTIKKIKKKSFWNYGRIIFGSLIVALVLSSVSSYYSSPaqQVPQNpALEAFLAQFSQLKD 255 naked mole-rat
F1N4E5       323 --VQKSELGNQSPStSNQ--QMTGQPKSVSSVKTKRYW-PFAVIAALLIGGFLYTRPP--EAETT-AVQEFQNQMKQLMN 394 cattle
XP_008541823 319 --VQKSELWNQSPStSNQ--QVTGQPKNAPFVKTKWWL-LLVLIAALALGSFWLSPTP--EVETT-AVQEFQNRMKQLMK 390 Przewalski's horse
Q5JTV8       306 --ILKSELGNQSPStSSR--QVTGQPQNASFVKRNRWW-LLPLIAALASGSFWFFSTP--EVETT-AVQEFQNQMNQLKN 377 human
EHB02130     306 --IQMSELGNQSPSlSSQ--QVAEQPRNEYFFKKKWFLCLLVVISVLVLWNFSFIHMP--GVETT-AVQMFQNQMKQLRN 378 naked mole-rat
Q5PQX1       307 --IQKSDFGNQSPStSRQ--QAAVQPPDESSVKIKWW--LLILVAALAMGIYWFFHTP--VVETT-AVQEFQNQMKQLQS 377 Norway rat
EGW10153     317 --IQESEFGNQSPStSGQ--QPAEQPDNEPSVNRKRW--LLGLVVSLAIGLLWFFYTP--AVQTT-AVQEFQNQMKQLQS 387 Chinese hamster
XP_019656872 330 --IQKTELGNWSPStSSQ--QVTGQPKSASFIKT-WWW-LPVLIVSLAVGSFLFTPSP--EVGTT-AVQEFQNQMRQLMN 400 giant panda
XP_014311547 332 --FQKSEFGNQSPStFSQ--HMTGQPKNASFVKMKWWWLPIPVLLILVLGSWWYTHVP--EVEGT-AVxEFQNQMKQLMI 404 little brown bat
XP_010589283 323 THVQKSALGNQSPSiSSRqvTGQPKTTGFMPW-----RWLFLLIAVIAIGIFWSSRNP--EVETT-AVQEFQNQMKQLMN 394 African savanna...
EHB02131     256 KFPGQSSFLWQRGRKFLQKHLNASNP-TEPATIIFTAAQEGRETLKCLSHHVADAYTSSQKVSAITINGAERAFQDSDTV 334 naked mole-rat
F1N4E5       395 KYQGQDEKLWKRSQTFLEKHLNGSQSrPQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVPAIRIDGASKATRDSDTV 474 cattle
XP_008541823 391 KYQGQDEKLWKRSLTFLEKHLNSSQPrPQPAILLLTAAQDAEQALKCLSEQIADAYSSVHSVRAIRIDGAGKATQDSDAV 470 Przewalski's horse
Q5JTV8       378 KYQGQDEKLWKRSQTFLEKHLNSSHPrSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAIRIDGTDKATQDSDTV 457 human
EHB02130     379 KYQGQDEKLWERSLMFLQKHLNSSHPrPQPAILLLTAAQDAEEALKCLSEQIADAYSSFRSVRAIRIDGTGKAAQDSDVV 458 naked mole-rat
Q5PQX1       378 KYQSQDEKLWKRGTTFLEKHLNSSLPrPQPAILLLTAAQDAAEVLKCLSEQIADAYSSFRSVRAIRIDGAGKAAQDSDLV 457 Norway rat
EGW10153     388 KYQSQDEKLWKRGTTFLERHLNSSVPrPQPAILLLTAAQDAKEVLKCLSEQIADAYSSFRSVRAIRIDGAGKAAQDSDLV 467 Chinese hamster
XP_019656872 401 KYQGQDEKLWKRSLTFLEKHLNSSQPrPQPAILLLTAARDAEEVLRCLSEQIADAYSSFRSVRAIRIDGAGKATQDSDVV 480 giant panda
XP_014311547 405 KYQGQDEKLWKRSLTFLEKHLNSSQPrPQPAILLLTAARDAEEALKCLSEQIADAYSSHRSVRAIRIDGTGRATEDSDAV 484 little brown bat
XP_010589283 395 KYRGQDEKLWKRSLTFLEKHLNSSIPrPQPAILLLTAARDAEEVLKCLSEQIADAYSSFRSVRAIRIDGTGKAAQDSDTV 474 African savanna...
EHB02131     335 KLFVDLELSYGFEKGQKAAVVHHFESLPAGSTLIFYKYCDHENAAFKDVVLVLTVLLEEETLEANVGPRETEEKVRDLLW 414 naked mole-rat
F1N4E5       475 KEEVDQELSNGFRNGQNAAVVHRFESLPAGSTLIFYKYCDHESAAFKDVALVLTVLLEEETLGTSLGLKEIEEKVRDFLQ 554 cattle
XP_008541823 471 KLEVDQELSNGFRNGQNAAVVHRFESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLETSLGLKEIEEKVRDFLK 550 Przewalski's horse
Q5JTV8       458 KLEVDQELSNGFKNGQNAAVVHRFESFPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGLKEVEEKVRDFLK 537 human
EHB02130     459 KLEVDQELSNGFTNGQNAAVVHRLESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEKTLGTSLGLKEIEEKVRDFLK 538 naked mole-rat
Q5PQX1       458 KHEVDQELTDGFRNGQNAAVVHRFESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEQTLEASLGLKEIEEKVRDFLK 537 Norway rat
EGW10153     468 KQEVDQELSNGFRNGQNAAVVHRFESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEKTLKASLGLKEIEEKVRDFLK 547 Chinese hamster
XP_019656872 481 KQEVDWELSNGFRNGQNAAVVHRFESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGLKEIEEKVRDFLK 560 giant panda
XP_014311547 485 KLEVDQELSNGFQNGQNAAVVHRFESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGLKEIEEKVRDFLK 564 little brown bat
XP_010589283 475 KLEVDQELSNGFRNGQNAAVVHRFESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEDETLETTLGLKEIEEKVRDFLR 554 African savanna...
EHB02131     415 AKFTNSNTPSSFNHMDSDKLSGLWSRISHLVLPVQPG 451 naked mole-rat
F1N4E5       555 VKFTNSDTPNSYKHMDPDKLSGLWSRISHLVLPVQPE 591 cattle
XP_008541823 551 VKFTNSDTPNSYKHMDPDKLSGLWSRISHLVLPIQPE 587 Przewalski's horse
Q5JTV8       538 VKFTNSNTPNSYNHMDPDKLNGLWSRISHLVLPVQPE 574 human
EHB02130     539 VKFTSSSTPSSYNHMDPDKLNGLWSRISHLVLPVQPE 575 naked mole-rat
Q5PQX1       538 VKFTSSDTANSYNHMDPDKLNGLWSRISHLVLPVQPE 574 Norway rat
EGW10153     548 VKFTNSNKASSYNHMDPDKLNGLWSRISHVVLPVQPE 584 Chinese hamster
XP_019656872 561 VKFTNSDTPNSYKHMDPDKLSGLWSRISHLVLPVQPE 597 giant panda
XP_014311547 565 VKFTNSNTPTSYKHMDPDKLSGLWSRISHLVLPVQPE 601 little brown bat
XP_010589283 555 VKFTSSDTPDSYNHMDSDKLSGLWSRISHLVLPVQPE 591 African savanna elephant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap