5OJQ,3J9O


Conserved Protein Domain Family
T6SS_VipA

?
pfam05591: T6SS_VipA 
Click on image for an interactive view with Cn3D
Type VI secretion system, VipA, VC_A0107 or Hcp2
VipA is a family of Gram-negative bacterial proteins that form part of the type VI pathogenic secretion system. Members have been variously defined as VC_A0107 family, Hcp2 and VipA, for ClpV-interacting proteins. VipB and VipA proteins interact very closely to form the shaft of the pathogenic penetrating needle system.
Statistics
?
PSSM-Id: 398944
Aligned: 112 rows
Threshold Bit Score: 143.746
Threshold Setting Gi: 122309388
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5OJQ_G                  4 GSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHAEQTPLEERATVTVDKNNFEAVMRESELKITATVKNKLTDd 83 
calssnu:BYI23_C010240   5 QREIPKSRVSITLDLHTGGAQKKVELPLKLLVAGDFSAGREQAPLSERKKVNIDKNNFDAVLADYAPDLKFAAENTLASd 84  Burkho...
jgi:Rmet_0625           6 QNEVPKARVNIKLDLHTGGAQKKVELPLKLLVMGDYSNGQETRALAEREKVSINKNNFNSVLADFNPKARIAVESTLARd 85  Cupria...
wugsc:KPN_01322         6 QNEVPRARINLKLSLHTGGAQKKVELPLKLLTIGDFSHGKENRPLSEREKINVNKNNFNSVLSEFSPEVNLSVPNTLAGn 85  Klebsi...
goetting:EBL_c11480     6 QNEVPKARINLKLDLHTGGASKKTELPLKLLIAGDFSNGQESAPLPERKKVNLNKNNIDAVLFEYSPKVNLTVKNTLAGd 85  Shimwe...
Q7N240                  6 QNEIPKSRINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEHLPLGERKKVAINKNNFDSVLAEFSPAINLTVKNTLAGd 85  Photor...
Q0WI63                  7 QNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNINKNNFNSVLAEFQPSLKLAVPDTLAGd 86  Yersin...
Q3A0Q8                  6 QKEIPKARINLALDVETGGHQKKTELPLKMLVMGDFSNGKTKGKIADRQRININKNNFESVMADLAPSVRFDVPNLLAKd 85  Peloba...
jgi:Hhal_0161          19 QQEVPKSRVNITLDVDTGDARKTLELPLKMLVLGDFSNGQASGRLAERERVPIDRDHLDAVLGDLSPSLQVTVPDTFRGd 98  Halorh...
WP_013662785            6 QSEIPRARVNIALDLDSGSGKKKKELPMKLLVMGDFSNGQSEGELSERERVNINGNNLEKVIANMAPKMEFAVPNRIKEg 85  Marino...
5OJQ_G                 84 eNAELPVELNFKSLADFAPDAVASQVPELKKLIELREALVALKGPLGNIPAFRERLQSLLNSEESREKLLAE 155
calssnu:BYI23_C010240  85 -GSELPVDLSFRSMKDFEPEQVARQIPELQALLAVRNLLRDLKSNLLDNGTFRREFEKILKNKELSDKLRGE 155 Burkholderia s...
jgi:Rmet_0625          86 -GSELPVDLDFKSMDDFKPEVVASRVPELRALMAARNLLRDLKSNLLDNAMFRRELEKILKDPGLSERLRAD 156 Cupriavidus me...
wugsc:KPN_01322        86 -GEEENVRLRFTDIKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKELEAILKDPALSQELRDE 156 Klebsiella pne...
goetting:EBL_c11480    86 -GSEDNISLIFRSMKDFSPEQVSRQIPQLKAMLSMRNLLRDLKANLLDNQAFRKELEKILLDPALSAELREE 156 Shimwellia bla...
Q7N240                 86 -GSEENIALIFRQIKDFEPEQIARQIPQLRALLSMRHLLRDLRSNLLDNTTFRRELEHILQDQALSDELRAE 156 Photorhabdus l...
Q0WI63                 87 -NTDTAVSLTFNDMKDFEPENVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRELENILKDDALSDELRAE 157 Yersinia pestis
Q3A0Q8                 86 -GSDFSIDLAFQSMKDFRPDSVAHQIPEMHSLMAMRNLLKDLKSNLLDNAKFRKKLEKIVSNQPQLEGLKQQ 156 Pelobacter car...
jgi:Hhal_0161          99 -GSQIRVALKIDGFHAFSPEAVARQIPQVNNLLAMRNLLKDLKSNVLDNARFRRELERIVQNQKELEGVMGE 169 Halorhodospira...
WP_013662785           86 -AGDIAVSLTAKRFDSFHPEQVAAQIPELSDLLSMRNLLKDLKSNLLDNATLRKEVERILNTQPDMDALKTE 156 Marinomonas me...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap