Conserved Protein Domain Family
DUF768

?
pfam05589: DUF768 
Protein of unknown function (DUF768)
This family consists of several uncharacterized hypothetical proteins from Rhizobium loti.
Statistics
?
PSSM-Id: 398943
Aligned: 2 rows
Threshold Bit Score: 127.268
Threshold Setting Gi: 123544970
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2YBE2  1 MSNRFLRWAKTWIEENIPPGANSDIESYEVKAKRLSEKLFAEAAAANFTNFETEEERERVTPLVLAA 67  Nitrosospira multiformis ATCC 25196
Q2YBE2  1 MSNRFLRWAKTWIEENIPPGANSDIESYEVKAKRLSEKLFAEAAAANFTNFETEEERERVTPLVLAA 67  Nitrosospira multiformis ATCC 25196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap