Conserved Protein Domain Family
Peptidase_S55

?
pfam05580: Peptidase_S55 
SpoIVB peptidase S55
The protein SpoIVB plays a key role in signalling in the final sigma-K checkpoint of Bacillus subtilis.
Statistics
?
PSSM-Id: 398939
Aligned: 190 rows
Threshold Bit Score: 259.254
Threshold Setting Gi: 524720529
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCZ29122               209 GVYKIGVWVRDSAQGIGTMTYET-ADGHFGALGHGIADADIGELLALSKGSVYDTCILAVHTSDGTKPGELTGILSFDEe 287 Firmi...
WP_015045112           158 QRYRIGLFIRDEAAGVGTLTFTEpDTKIFGALGHVITDIDTNDQIELSDGKIVESTIYAIEKGQRGDPGEKIGTFMLQS- 236 Dehal...
WP_013625040           158 NRNRIGLFIRDEAAGVGTLTFIEpKQQIFGALGHVITDMDTNEKIELKDGKVIESSISSIEKGKNGDPGEKIGTFMINS- 236 Syntr...
jgi:Desaci_3326        208 GRYRVGLFVRDEAAGVGTLSFIDpVTKQYGALGHVITDADTNQKLEVYNGKIMASTIYAIQKGKRGHPGEKIGSFVTNS- 286 Desul...
PRJNA61369:DESME_10250 204 NRYRVGLYVRNEAAGVGTLTFYEpQTRKYGALGHVINDADTNQKIEVANGSVIASSIYAIEKGRRGHPGEKVGSFVNQT- 282 Desul...
P17896                 203 GKYRIGLYIRDSAAGIGTMTFYEpKTKKYGALGHVISDMDTKKPIVVENGEIVKSTVTSIEKGTGGNPGEKLARFSSER- 281 Bacil...
jgi:Bcoa_2866          202 QSYKLGLYIRDSAAGIGTMTFIDpKTKKYGALGHVISDMDTKKPIVVEKGRIVNSVVTSIEKGKNGSPGEKLARFTEEG- 280 Bacil...
CCG45811               190 KEYQIGLYIRDSAAGIGTMTFYHpDSKKYGALGHVISDMDTKKPIEIHEGTIVRSHVTSIEKGSQGVPGEKRAEFSLKD- 268 Halob...
Q8EQ48                 176 KQFKIGLYIRDSAAGIGTMTFYDpVSGKYGALGHVISDMDTKKPIEIEDGSIVHSSVTSIEKGDNGIPGEKQARFEEGN- 254 Ocean...
BAM47314               203 DSYKIGLYIRDSAAGIGTMTFLDpQTNMYGALGHVIADIDTKEPIEIKSGTIVKSKITSIQKGNSGLPGEKRATFNKNE- 281 Amphi...
CCZ29122               288 DYLGRIEENTEAGIYGsfcKPskadsGdeviietsldtsgkSDVTESMkyPIALKQEVQEGAAQIYTSF-DGTGAFYDIE 366 Firmi...
WP_015045112           237 NFTGKIAKNSASGIFG---IY-----Egev---------rnPYFSTIV--PIAWKSEVEVGPAKIYTVLkDNTIEEFDIK 297 Dehal...
WP_013625040           237 NFSGKINKNTESGIYG---TL-----Egkf---------tnKFYKDGI--LLGLKSEIIPGPAKIYTVLkNNTIEEFDIE 297 Syntr...
jgi:Desaci_3326        287 SFSGTIEKNTITGIFG---KL-----Rgql---------anPYYKEAI--PVGWESEVKEGPAKIYTVIqGEKIEEFDIN 347 Desul...
PRJNA61369:DESME_10250 283 LFTGNIEKNSISGIFG---TM-----Qgki---------lnPYFKEAI--PVAWEAEIKEGPAKIYTVLdGEKIEEYEVQ 343 Desul...
P17896                 282 KTIGDINRNSPFGIFG---TL-----Hqpi---------qnNISDQAL--PVAFSTEVKKGPAEILTVIdDDKVEKFDIE 342 Bacil...
jgi:Bcoa_2866          281 -RIGNITKNSPFGIFG---QL-----Dpga---------kdSTYAKPM--PIALSDQVKTGPAKILTVVdGKKVEAYSIK 340 Bacil...
CCG45811               269 DRLGTITKNTPFGIFG---EL-----Dgsm---------dnKSYPNGL--PVGYAEQVEEGPAKILTVLdGDKMQTFDVE 329 Halob...
Q8EQ48                 255 HRIGSIKRNTDYGIFG---VL-----Ekei---------dhEKYNKPF--PVALSHEVEEGPAKILTVInGEEIEEFDIE 315 Ocean...
BAM47314               282 NLLGNITKNSSFGVFG---EL-----Didl---------skEDLTEPI--PIAYSHEVVEGPAQILTVIdDEKVEAFDIE 342 Amphi...
CCZ29122               367 ITQLRYEDDG-NQNITLTVTDPVLLAKTGGIVQGMSGSPILQNGKIVGAVTHVLVRQPEKGYGIFIENMM 435 Firmicutes bact...
WP_015045112           298 IEKIMQY-RTdNKNMIIRITDPELLEKTGGIVQGMSGSPIIQNGKIVGAVTHVFVNDSTRGYGIFIEKMI 366 Dehalobacter sp...
WP_013625040           298 IEKIMLN-RNdNKNLIIKITDPKLLDQSGGIVQGMSGSPIVQNQKLIGAVTHVFVNDSTRGYGIFIENMI 366 Syntrophobotulu...
jgi:Desaci_3326        348 IDRVMYN-RTdSKNMIVRVTDPRLLEATGGIIQGMSGSPIVQNGKLIGAVTHVFVNDSTRGYGVFIQNMI 416 Desulfosporosin...
PRJNA61369:DESME_10250 344 IERIMHN-RTdSKNMVIRVTDQRLLDKTGGIIQGMSGSPIVQDGKIIGAVTHVFVNDATRGYGVFIQNMI 412 Desulfitobacter...
P17896                 343 IVSTTPQKFPaTKGMVLKITDPRLLKETGGIVQGMSGSPIIQNGKVIGAVTHVFVNDPTSGYGVHIEWML 412 Bacillus subtil...
jgi:Bcoa_2866          341 IVSTIPQKFPaTKGMVIKITDPELLKKTGGIVQGMSGSPIIQNGRLVGAVTHVFVNDPTSGYGVHIEWML 410 Bacillus coagul...
CCG45811               330 IVSNMPKKSPvTKGMIVKITDPKLLDKTGGIVQGMSGSPIIQNGKIIGAVTHVFVNDPTSGYGVHIEWML 399 Halobacillus ha...
Q8EQ48                 316 IVSSVPQNNPsTKGMVIQITDPKLLKETGGIVQGMSGSPIIQNGKVIGAVTHVFVNDPTSGYGVHIEWML 385 Oceanobacillus ...
BAM47314               343 IISTIEQKNPaTKGMVIKVTDERLLEKTGGIVQGMSGSPIIQNNKLIGAVTHVFVNDPTSGYGIHIEWML 412 Amphibacillus x...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap