5WX1


Conserved Protein Domain Family
Peptidase_S31

?
pfam05578: Peptidase_S31 
Pestivirus NS3 polyprotein peptidase S31
These serine peptidases are involved in processing of the flavivirus polyprotein.
Statistics
?
PSSM-Id: 398938
Aligned: 3 rows
Threshold Bit Score: 429.936
Threshold Setting Gi: 1346739
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5WX1_A   51 GPAVCKKVTEHEKCTTSIMDKLTAFFGVMPRGTTPRAPVRFPTSLLKIRRGLETGWAYTHQGGISSVDHVTCGKDLLVCD 130 
P19711 1680 GPAVCKKITEHEKCHINILDKLTAFFGIMPRGTTPRAPVRFPTSLLKVRRGLETAWAYTHQGGISSVDHVTAGKDLLVCD 1759 Bovine viral diarrh...
P19711 1680 GPAVCKKITEHEKCHINILDKLTAFFGIMPRGTTPRAPVRFPTSLLKVRRGLETAWAYTHQGGISSVDHVTAGKDLLVCD 1759 Bovine viral diarrh...
5WX1_A  131 TMGRTRVVCQSNNKMTDESEYGVKTDSGCPEGARCYVFNPEAVNISGTKGAMVHLQKTGGEFTCVTASGTPAFFDLKNLK 210 
P19711 1760 SMGRTRVVCQSNNRLTDETEYGVKTDSGCPDGARCYVLNPEAVNISGSKGAVVHLQKTGGEFTCVTASGTPAFFDLKNLK 1839 Bovine viral diarrh...
P19711 1760 SMGRTRVVCQSNNRLTDETEYGVKTDSGCPDGARCYVLNPEAVNISGSKGAVVHLQKTGGEFTCVTASGTPAFFDLKNLK 1839 Bovine viral diarrh...
5WX1_A  211 GWAGLPIFEASSGRVVGRVKVGKNEDSKPTKLMSGIQTVSKSTTDLTEMVK 261 
P19711 1840 GWSGLPIFEASSGRVVGRVKVGKNEESKPTKIMSGIQTVSKNRADLTEMVK 1890 Bovine viral diarrhea virus 1-NADL
P19711 1840 GWSGLPIFEASSGRVVGRVKVGKNEESKPTKIMSGIQTVSKNRADLTEMVK 1890 Bovine viral diarrhea virus 1-NADL
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap