Conserved Protein Domain Family
V_cholerae_RfbT

?
pfam05575: V_cholerae_RfbT 
Vibrio cholerae RfbT protein
This family consists of several RfbT proteins from Vibrio cholerae. It has been found that genetic alteration of the rfbT gene is responsible for serotype conversion of Vibrio cholerae O1 and determines the difference between the Ogawa and Inaba serotypes, in that the presence of rfbT is sufficient for Inaba-to-Ogawa serotype conversion.
Statistics
?
PSSM-Id: 114305
View PSSM: pfam05575
Aligned: 2 rows
Threshold Bit Score: 550.823
Threshold Setting Gi: 75427974
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q56677   1 MKHLIKNYVQKLIKTELDAIQSKSVHDNRNFIYNGEFLILESEFGWHCFPRVQLNHALSYKNPNFDLGMRHWIVNHCKHD 80  Vibrio cholerae
Q07029   1 MKHLIKNYVQKLIKTELDAIQSKSVHDNRNFIYNGEFLILESEFGLHCFPRVQLNHALSYKNPNFDLGMRHWIVNHCKHD 80  Vibrio cholerae
Q56677  81 TTYIDIGANVGTFCGIAARHITQGKIIAIEPLTEMENSIRMNVQLNNPLVEFHHFGCAIGENEGENIFEVYEFDNRVSSL 160 Vibrio cholerae
Q07029  81 TTYIDIGANVGTFCGIAARHITQGKIIAIEPLTEMENSIRMNVQLNNPLVEFHHFGCAIGENEGENIFEVYEFDNRVSSL 160 Vibrio cholerae
Q56677 161 YFKKNTDIADKVKNSQVLVRKLSSLDISPTNSVVIKIDAEGAEIEILNQIYEFTEKHNGIEYYICFEFAMGHIQRSNRTF 240 Vibrio cholerae
Q07029 161 YFQKNTDIADKVKNSQVLVRKLSSLDISPTNSVVIKIDAEGAEIEILNQIYEFTEKHNGIEYYICFEFAMGHIQRSNRTF 240 Vibrio cholerae
Q56677 241 DEIFNIINSKFGSKAYFIHPLSSAEHPEFNKATQDINGNICFKYVS 286 Vibrio cholerae
Q07029 241 DEIFNIINSKFGSKAYFIHPLSSAEHPEFNKATQDINGNICFKYVS 286 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap