Conserved Protein Domain Family
ASFV_J13L

?
pfam05568: ASFV_J13L 
African swine fever virus J13L protein
This family consists of several African swine fever virus J13L proteins.
Statistics
?
PSSM-Id: 114299
View PSSM: pfam05568
Aligned: 2 rows
Threshold Bit Score: 263.268
Threshold Setting Gi: 81993371
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q65273   1 MDSEFFQPVYPRHYGECLSPVSTPSFFSTHMYTILIAIVVLIIIIIVLIYLFSSRKKKAAAAIEEEDIQFINPYQDQQWS 80  African swine fever v...
Q89784   1 MDSEFFQPVYPRHYGECLSSTPAPSFFSTHMYTILIAIVVLIIIIIVLIYLFSSRKKKAAAAIEEEDIQFINPYQDQQWA 80  African swine fever v...
Q65273  81 EVTPQPGTSKPAGATTASAGKPVTDRPATNrlvadRPATNRPVMDNPVMATGGPEAASATAsaaasdpaYPAEPYTTVTT 160 African swine fever v...
Q89784  81 GVTPQPGIAKPAGASTGSAGKPVMGRPVTN-----KPVTNKPVTDRLGMAAGGPAAASAPA--------HPAELYTTATT 147 African swine fever v...
Q65273 161 QNTASQTMSAIENLRQRSTYTHKDLENSL 189 African swine fever virus
Q89784 148 QNTASQTMPADENLRQRNTYTHKDLENSL 176 African swine fever virus Malawi LIL 20/1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap