Conserved Protein Domain Family
Bt_P21

?
pfam05560: Bt_P21 
Bacillus thuringiensis P21 molecular chaperone protein
This family contains several Bacillus thuringiensis P21 proteins. These proteins are thought to be molecular chaperones and have mosquitocidal properties.
Statistics
?
PSSM-Id: 114291
View PSSM: pfam05560
Aligned: 2 rows
Threshold Bit Score: 314.298
Threshold Setting Gi: 446060374
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_000138229   1 MTENGVFYKIFTTENNNFCINPTLLERVFKNNLDEFDFSLVKKNLEHEKNCVITSTMNQTISFENMNSTEMGHKTYSFLN 80  Bacillus
P94595         2 DAENRAFYKIFTLKNNNLCKNSTLLEKIFKNNVEEFDFSLVKQNLEHEKNCVITSTMNQTIFFENMNSKEMGNKAYSFFN 81  Bacillus thurin...
WP_000138229  81 QTVLNNKGNSSLEEQVSNIFYRCVYMEVGKSSSYIKPLEQDSNKIRYVCSLLFIVPYKNNITSIIPVNLQLTLLSKNVKQ 160 Bacillus
P94595        82 QTVLNNKGNTSLEEQISDIFDRCVYMNAEKSSSYIKLLEQDYNQVDMFVSLIFIGPYRHNLILITPVTLHLTLIPKNVKN 161 Bacillus thurin...
WP_000138229 161 SSSTNIFSGDIHFNMVTMTYLT 182 Bacillus
P94595       162 NSFKNLFSGDMHFNMVTMTHLT 183 Bacillus thuringiensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap