Conserved Protein Domain Family
DUF763

?
pfam05559: DUF763 
Protein of unknown function (DUF763)
This family consists of several uncharacterized bacterial and archaeal proteins of unknown function.
Statistics
?
PSSM-Id: 398930
Aligned: 74 rows
Threshold Bit Score: 406.137
Threshold Setting Gi: 504550338
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Trebr_1285   9 GHADLPLHGGTVPKWLAERMKTLGGLIIESLVYNYGKREVLSRLSDPLWFQSLGAVLGMDWHSSGITTSVMYALKRSVnp 88  Treponema bre...
Q8TYA4           9 rAAELRL-VKCPPPRHFPEMVKLSRALFRLLVEEHGTDGALEKLADPRWFQSLACLLGYERNTSGSTTVVTAALREAL-- 85  Methanopyrus ...
BAJ47170         5 GTATLWLTEGPVPH--FREMVELGREIMRALCAQVGYEETVRRFADPFWLSSLACALGFEWDTSGQTTVTLKALSLGL-- 80  Candidatus Ca...
WP_012965224     2 ksIYLPLHHGKAPYWLLNRMKKLCYPIVRIIVDEFGYNELIKRLSDPIFFQSLSNVLGFDWNSSGSTTVLTGVLKAAL-- 79  Ferroglobus p...
O28776           2 keIYLPLHHGKAPHWLLSRMKKLAKPIVKLIVLEYGEREFLERLSNPIFFQSLSNVLGFDWNSSGVTTVLTGVLKAVI-- 79  Archaeoglobus...
jgi:Arcve_0939   3 gSIYLPLHYGKAPPWLLGRMKKLAKPIITLIIDEFGEEEFFERLSDPIFFQSFSNVLGFDWNSSGTTTVLTGVLKSVL-- 80  Archaeoglobus...
EQB66386         5 GISDLPLHYGHPPEKLFKHMVDLTGAIIDIINSWYSPSEIIKRLSDPIWFQSLSLVTGFDWNSSGTTTSTLYALKEAL-- 82  Thermoplasmat...
EQB69646         8 GTAYLPLHYGKPPELLYRKIVRLTGQICELISETYGTKELIWRMADPVWFHSLSLVTGFDWNSSGTTTTTLHALKEYS-- 85  Thermoplasmat...
Q9HJ77           7 GISALPLHYGHPPEYLFKRAVKLSGIMAEIIVDTYGQGELIRRLADPFWFHSLSLVTGFDWNSSGTTVFTLSALKEYL-- 84  Thermoplasma ...
EQB70626         5 GSAILPLHYGHPPEYLYRRMVKLGGLISDLIIERFGVEEYLEKVSDPFWFHSLSLAIGFDWNSSGTTTATLSAIKEHYs- 83  Thermoplasmat...
jgi:Trebr_1285  89 HARELGVCICGGRGVYSRRTPDELRFLADATGLDGDT---LVRASKLCAKVDNTAVQDGFQLYQHNFIVTDDGDWAVVQQ 165 Treponema bre...
Q8TYA4          86 DPEEHGIAVAGGKGRLALETPKRVRELADRMNLDPRQ---LVTASRLTARSDSVCLQDGHDLYHHVIVFDENGRWVVIQQ 162 Methanopyrus ...
BAJ47170        81 MGTDIPVRVLGGKGAEMRMAQLEAGKLLAEIGV--REvgeIRRAMRLTTSVDNAALQDSYDIYFQAAAVSESGQWAIINQ 158 Candidatus Ca...
WP_012965224    80 NESDLEVRVAGGKGNNALKTPEEIEKFGEELGLREKKleeLKKVSRLVAKVDNVMLQDGYDLYHHAIVFTRK-DWCVIQQ 158 Ferroglobus p...
O28776          80 NNEEFDIRIAGGKGGNALKTPEEIMNYSEQIGADGEK---LVEFSRLAAKADNAALIDGYSLYHHAVIFTPR-YFTVIQQ 155 Archaeoglobus...
jgi:Arcve_0939  81 NTPDFDIRVAGGKGKEGLKTPEHIVKFADELGI-GNKaeeLIEVSRLTAKVDGVALQDGYDIYHHALIFSRK-HCVVIQQ 158 Archaeoglobus...
EQB66386        83 KVSDTGICIAGGKGKDMTGTVREIEKNVQDKIVSDQDglkLINFSKRIARADSNLLQDGYDLYIHSIFYRSHKDWTIIQQ 162 Thermoplasmat...
EQB69646        86 NSKDLDFFVAGGKGIHMKEKSEDISTRSQLFAT-EKIperVRKETDLAAKIDENLLQDTYDLYIHSVVLDYKGNYSVIQQ 164 Thermoplasmat...
Q9HJ77          85 STRDLGVKVCGGKASAMADMRADLLSSVETGILKEDDkeyVYENARRIAKIDNSLLQDGYDLYMQFVVVSDRGRHAVIQQ 164 Thermoplasma ...
EQB70626        84 RLKDSPVFILGGKGRHLGEMAAESMEIVATGALSESKihrIMEDARRIARVDQNLLIDGFDLYMQFLVLDTHGKWSIVQQ 163 Thermoplasmat...
jgi:Trebr_1285 166 GMNPLTKTARRYHWCs-PSVTSFVEEPHAGIVGENRGT-ILNLTDRRSRPARDAITDMARERP-------------DRLV 230 Treponema bre...
Q8TYA4         163 GMDVDRKTARRYHWLd-SEVSEFV-EGHPVVADETRK--VLSLQGDRADKCREAVLDLVGDGP-------------DRVL 225 Methanopyrus ...
BAJ47170       159 GMNTVNKTARRYHWs--SDRGLGVEEPHTEILSDTVEDvVLDLTSTTSAETRQTILEVLEDTPp------------SRLN 224 Candidatus Ca...
WP_012965224   159 GMNEKEKLARRYHh---SSFDWKIEKPHSGIFAERVEKeVMNLASEDSDEARKVILDIVKDGT---------------FK 220 Ferroglobus p...
O28776         156 GMNETERMARRYHWNv-YSSVPELENVHEGIITERRENeVVNMLSDISRDAKRLCVDIVRDGS---------------FR 219 Archaeoglobus...
jgi:Arcve_0939 159 GMNEHNRLARRYHWKpsDFSAVSAEEPHSGIIAVRRENaVMNLVARDSRENRETILDVVRDGT---------------FR 223 Archaeoglobus...
EQB66386       163 GIDKDGRMARRYQWHs-SLADKILDDGRSGILSHERKDrVLDLTTSKSRDNRNGMIETVRD-PlilrtvnnvrkngQFKL 240 Thermoplasmat...
EQB69646       165 GLNYEEKMARRYHWSs-KHIMEKMEESRMGIRTDLLSDnCLDLSSPLSRKSRDSMLKAIKEKPkis-------nenQRTL 236 Thermoplasmat...
Q9HJ77         165 GMNSEDRMARRYHWL--IGNERVDVEGRYGLSADKTSLnVLDLSATESRDNRSAIVASVREGEvwrf-----rsgaQSTL 237 Thermoplasma ...
EQB70626       164 GMNPQQRMARRYHWIs-RTGLDFFNDGRNGISAPRQMDrVVDLTTRNSEGNRRSMLEMAREDPlryrmk--ltegpQKTL 240 Thermoplasmat...
jgi:Trebr_1285 231 AEIRLMQrcrdvapaereadpmqpelfpvagaaavrtgavspftaapllapapvsdisgsyrsiVLPARHEVtaadv--d 308 Treponema bre...
Q8TYA4         226 REWRAVRnsisg------------------------------------------------pldeYLGREGGVevpdgwvp 257 Methanopyrus ...
BAJ47170       225 EDLAQVKaiarkqh-----------------------------------------------tltstfeELPTipkhlspp 257 Candidatus Ca...
WP_012965224   221 RDYRKLLslvry------------------------------------------------kesfKVPRKID--------- 243 Ferroglobus p...
O28776         220 RDYERMIsvlrw------------------------------------------------rkglRVPKKLD--------- 242 Archaeoglobus...
jgi:Arcve_0939 224 RDYSKLLsivry------------------------------------------------resvSVPRRID--------- 246 Archaeoglobus...
EQB66386       241 DYFQEDLkftsy-------------------------------------------------------------------d 253 Thermoplasmat...
EQB69646       237 DYYSD-Ekvlnl-------------------------------------------------------------------a 248 Thermoplasmat...
Q9HJ77         238 DNFS--Lpfldl-------------------------------------------------------------------s 248 Thermoplasma ...
EQB70626       241 DNFQNQQdvlrl-------------------------------------------------------------------d 253 Thermoplasmat...
jgi:Trebr_1285 309 lkrLGAVLSTAYENGTENFENLLLTEGLGPRTLQSLALVSEVVYGAPARFTDPARFSFAHGGKDGHPFPV 378 Treponema brennaborense...
Q8TYA4         258 rrlDRDALRRLYEVNPTDFKEFLTVRGVGPSLVRALALIAEVVYGEGPDRRDPAEYTAAFGCKSGDPYPV 327 Methanopyrus kandleri
BAJ47170       258 nrlDEETIRRA--KNVSSFDELLTTQGVGAATLRGLAYIAALVYGSKVSWRDPVKFSYAFGTKSGKPYPV 325 Candidatus Caldiarchaeu...
WP_012965224   244 ----WRVLENCY---IDNFEDLLLVRGLGKGAMRALALISELIYDAEYDKKDPAKFSFALGGKDGVPYPV 306 Ferroglobus placidus
O28776         243 ----WKVVERAYNLQPERFEELLLIRGFGRETIRALALVAEIIYNTEYDKTDPAKYCFAVGGKDGVPFPV 308 Archaeoglobus fulgidus
jgi:Arcve_0939 247 ----WKAIERAYNLQPERFERLLLVRGVGKGAIRALALIADIIYNAEYSTQDPAKYCFAVGGKDGVPFPV 312 Archaeoglobus veneficus...
EQB66386       254 lhvNWENLRKIYEYQPSNFDELFMLKGVGKSAIRALSYISEVIMGKPPSYSDPLRYTFALGGKDGIPKPV 323 Thermoplasmatales archa...
EQB69646       249 ikvPWKNLEKIYEFEPSNFDDLLFIPGAGKSTIRALCYIAEVITGERPSYEDPVRYSYALGGKDGIPKPV 318 Thermoplasmatales archa...
Q9HJ77         249 grvNWKKLRDLYEYGVDDFEKIYMEKGIGKSTLRALSYIAEVIYGPKASFRDPVKFSFAVGGKDGIPKPV 318 Thermoplasma acidophilum
EQB70626       254 yriNWAKMREIYEYQPSSFQDIAFMKGMGKSTIRALSYLAEIIYGEKPSFRDPVKFSFAVGGKDGVPKPV 323 Thermoplasmatales archa...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap