2VV5


Conserved Protein Domain Family
TM_helix

?
pfam05552: TM_helix 
Click on image for an interactive view with Cn3D
Conserved TM helix
This alignment represents a conserved transmembrane helix as well as some flanking sequence. It is often found in association with pfam00924.
Statistics
?
PSSM-Id: 398927
Aligned: 288 rows
Threshold Bit Score: 28.1113
Threshold Setting Gi: 74532244
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2VV5_F                15 SWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRKIDAT 64  Escherichia coli
WP_014107724          12 SALSIFWTEIAGFLPNLIATIIVVVIGLYLSKLVTKWIAKIIQKVGFNEL 61  Glaciecola nitratireducens
CASKLGSI:C427_5441    12 NALTRFWTEIAGFLPNLIATIIFIFIGLLLSKFVTKWFAKVIEKVGFNTL 61  Paraglaciecola psychrophila 170
Q97WM7                99 GAASGYIQQIANYLPKLAGAIVLLTIGLTLVNILVDYMQRQIGARSQDDL 148 Saccharolobus solfataricus
CCX38722               5 tvwSNFLHGLAGFFINLVLAALIFFGGWFLARLAAKLTKKAISKGKVDPL 54  Clostridium sp. CAG:1013
CDD29783               5 giwSGFLQGLANFAGDLVLAALIFLGGWLLARLAARLTKKAISKGKVDAL 54  Firmicutes bacterium CAG:94
Q7NI41                12 rfqQSILDLLFLYLPNLVGALLIFLVGWLIAGVASRVVSGILQRVNFQKL 61  Gloeobacter violaceus
WP_023173897          12 rfqQSIVDLLFRYLPNLIAALLIFLVGWFIAALLSRIVRSILQRVNFQKL 61  Gloeobacter kilaueensis
Q7MRC2                10 GWSQSLLDSLFTFSPKLLAAILIAILGLYLAKLARRYTFRLLLKVTKDEI 59  Wolinella succinogenes
goetting:Ngar_c02160  33 NSLNQFATSIAESGPRIIAALILLGIGLLVGRVIGWVVKKVAQKMNVDQh 82  Candidatus Nitrososphaera gargensis G...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap