6HJF,4JUU,2AZP,1TM0


Conserved Protein Domain Family
Pro_racemase

?
pfam05544: Pro_racemase 
Click on image for an interactive view with Cn3D
Proline racemase
This family consists of proline racemase (EC 5.1.1.4) proteins which catalyze the interconversion of L- and D-proline in bacteria. This family also contains several similar eukaryotic proteins including Trypanosoma cruzi PA45-A, a protein with B-cell mitogenic properties which has been characterized as a co-factor-independent proline racemase.
Statistics
?
PSSM-Id: 398923
Aligned: 14 rows
Threshold Bit Score: 424.017
Threshold Setting Gi: 480312349
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6HJF_A                  48 CIDMHTEGEAARIVTSGLPHIPGSNMAEKKAYLQENMDYLRRGIMLEPRGHDDMFGAFLFDPIEEGADLGIVFMDTGGYL 127 Trypa...
4JUU_B                  28 VIDSHTAGEPTRVVLAGFPDLGDGDLAQCRERFRSDFDHWRSAIACEPRGSDTMVGALLLPPRDPSACTGVIFFNNVGYL 107 Xanth...
2AZP_A                   8 IIDSHTGGEPTRLVIGGFPDLGQGDMAERRRLLGERHDAWRAACILEPRGSDVLVGALLCAPVDPEACAGVIFFNNSGYL 87  Pseud...
WP_010973452             7 CIDSHTCGNPVRLVAGGGPLLPHLPISERRDLFVRNHDWVRQALMFEPRGHDIMSGAVIYPAYRDDCDFAVIFIEVSGCL 86  Agrob...
Q8YJ29                   8 CVDGHTCGNPVRLVAGGGPNLNGSTMMEKCAHFLAEYDWIRTGLMFEPRGHDMMSGSILYPPTRPDCDVAVLFIETSGCL 87  Bruce...
Q92WS1                   8 CIDGHTCGNPVRLVSGGGPRLEGANMLEKRAHFLKEFDWIRTGLMFEPRGHDMMSGSILYPPTRPDCDVAVLFIETSGCL 87  Sinor...
PRJNA255042:J163_02380   9 VVDCHAEGEVGKVIVGGVGNIPGTTMFEKKLYLEQHRDDIRKLVLQEPRGATWHNANIILPPSHPEASMGFVILEATEYP 88  Xanth...
Q988B5                   9 VVGCHAEGEVGDVIIGGVLPPAGRTMMDKMITMERDHDHIRRMLICEPRGSVARHVNLLVPSTREDCAAGAIIMEPTEYP 88  Mesor...
A9CH01                   9 VISAHAEGEVGDVIVGGVKPPPGETIWEQSRFIARD-ETLRNFVLNEPRGGVFRHVNLLVPPKHPDADAAFIIMEPEDTP 87  Agrob...
Q9I489                   9 IVSCHAEGEVGDVIVGGVAAPPGATLWEQSRWIARD-QDLRNFVLNEPRGGVFRHANLLVPAKDPRAQMGWIIMEPADTP 87  Pseud...
6HJF_A                 128 NMCGHNSIAAVTAAVETGIVSVPAKATNVPvvLDTPAGLVRGTAHLQSGtesEVSNASIINVPSFLYQQDVVVVLPKPyG 207 Trypa...
4JUU_B                 108 GMCGHGTIGVVRTLAELGRIAPGQHR------IETPVGTVGVALADDGT-------VSIDNVESYRHAAGVEVDVPGH-G 173 Xanth...
2AZP_A                  88 GMCGHGTIGLVASLAHLGRIGPGVHR------IETPVGEVEATLHEDGS-------VSVRNVPAYRYRRQVSVEVPGI-G 153 Pseud...
WP_010973452            87 PMCGAGTIGLVTAAIEEGLVTPRIPG-RLS--IETPAGKVDIQYDKPGE---FVESVRIFNVASYLHAADVEVNVPGL-G 159 Agrob...
Q8YJ29                  88 PMCGHGTIGTVTMAIEQGLVTPKTPG-KLN--LDTPAGLVAIEYEQDGQ---YVERVRLTNVPAFLYAEGLEVECPDL-G 160 Bruce...
Q92WS1                  88 PMCGHGTIGTITMGIENGLITPREPG-KLS--IDAPAGKVDITYRQEGR---FVEEVRLTNVPSFLYAEGLAAEVEGL-G 160 Sinor...
PRJNA255042:J163_02380  89 AMSGSNTICVATVLLETGILPMQEPITDLV--LEAPAGLIRVRCDCKDG---KVTRVKLVNQPAFVYHLDAKVEVAGI-G 162 Xanth...
Q988B5                  89 PMSGSNTICVATVLLETGMVPMQEPETRFK--LDMPGGVIEVRAQCRDG---KCVSITLRNAPAFVDRLDASIEVEGL-G 162 Mesor...
A9CH01                  88 PMSGSNSICVSTVLLDGGIVPMQEPETHML--LEAPGGLVKVRAECRNG---KAERIFVQNLPSFAAKLDAELEVEGL-G 161 Agrob...
Q9I489                  88 PMSGSNSLCVATVLLDSGILPMREPLTRLL--LEAPGGLIEARAECRDG---KAERVEIRNVPSFADRLDAWIEVEGL-G 161 Pseud...
6HJF_A                 208 EVRVDIAFGGNFFAIVPAEQLGIDISVQNLSRLQEAGELLRTEINRSVKVQHPQLPHINTVDCVEIYGPPTNPEA--NYK 285 Trypa...
4JUU_B                 174 RVRGDVAWGGNWFFITEQA--PCALGLAQQRELTAYTEAIRLALEAA----GITGEAGGEIDHIEISGVAPDGSG--AAR 245 Xanth...
2AZP_A                 154 RVSGDIAWGGNWFFLVAGH--GQRLAGDNLDALTAYTVAVQQALDDQ----DIRGEDGGAIDHIELFADDPHA----DSR 223 Pseud...
WP_010973452           160 KLVVDIAYGGNYYAVIEPQVGWPGLDGMTAGDVVDLSQKLRDALGTICDPVHPDDERIRGVHHAIWCDRPVSAEA--DGR 237 Agrob...
Q8YJ29                 161 PIKVDVAYGGNFYAIVEPQENYTDMDDYSALQLIAWSPVLRQRLNEKYKFQHPELPDINRLSHILWTGKPKHPQA--HAR 238 Bruce...
Q92WS1                 161 EIVVDVAYGGNFYAIVEPQKNFRDMADHTAGELVGWSPKLRAALNAKYEFVHPEHPEIRGLSHIQWTGKPTQPEA--HAR 238 Sinor...
PRJNA255042:J163_02380 163 TVSADIAFGGMTFALVDASSLGFEIVPAEARELCEYGQKIKAAAAEQLDVAFPGNPDMPGITMTQFTGPLSRADGkfFSR 242 Xanth...
Q988B5                 163 TLTVDIAYGGMFYAIVDAKALGFSIAPDEARELAVAGEKIRRAAREQLDVVHPQFDHVRGVSIVQFAMPFQGPGN--VTR 240 Mesor...
A9CH01                 162 KLKVDTAYGGDSFVIVDAEAMGFSLKPEEAHEIARLGVRITNAANKALGFDHPENPDWRHFSFCLFAGKVERTAEglRAG 241 Agrob...
Q9I489                 162 SLQVDTAYGGDSFVIADARRLGFALRADEAAELVATGLKITHAANEQLGFRHPTNPDWDHLSFCQLAAPPERRDGvlGAN 241 Pseud...
6HJF_A                 286 NVVIFGNRQADRSPCGTGTSAKMATLYAKGQLRIGETFVYESILGSLFQGRVLGEERIPGVKvpvtkdaeegmlVVTAEI 365 Trypa...
4JUU_B                 246 NFVLCPGLAYDRSPCGTGTSAKLACLAADGKLAEGERWLQQGILGSAFEGSY----RHSGRG-------------IAPRI 308 Xanth...
2AZP_A                 224 NFVLCPGKAYDRSPCGTGTSAKLACLAADGKLLPGQPWRQASVIGSQFEGRYEWLDGQPGGP-------------IVPTI 290 Pseud...
WP_010973452           238 GAVFYGDKAIDRSPGGTGTSARMAQLHGKGRLKAGETFRQESLIGTIFEGKVEEETTVGSFS------------GIRPSI 305 Agrob...
Q8YJ29                 239 NAVFYGDKAIDRSPCGTGTSARMAQLAAKGKLKPGDEFIHESIIGSLFHGRVERAAEVAGRP------------AIVPSI 306 Bruce...
Q92WS1                 239 NAVFYGEKAIDRSPCGTGTSARIAQLAAKGKLKVGDEFVHESIIGSLFKGRVEAAAKVADRD------------AIIPSI 306 Sinor...
PRJNA255042:J163_02380 243 NTTIVSPGRCDRSPCGAGSSARLAALHAKGVLAKGDTLVHESIIGSRFECGIEDMSNVGDYP------------AVVPSI 310 Xanth...
Q988B5                 241 NTCIVSPGRSDRSPTGTGTSARMAVLQARGLMGVGDVLIHESIIGSRFTGRIVELAEIAGRK------------AIVPEI 308 Mesor...
A9CH01                 242 AAVAIQPGKVDRSPTGTALSARMAVLHARGEMKEGETLTAVSLIGSTFTGRILGTTTVGDRP------------AILPEI 309 Agrob...
Q9I489                 242 NAVVIRPGKIDRSPCGTGCSARMAVLQAKGQLRVGERFVGRSIIGSEFHCHIESLTELGGRP------------AILPCL 309 Pseud...
6HJF_A                 366 TGKAFIMGFNTMLFDPTDPFKNGFT 390 Trypanosoma cruzi strain CL Brener
4JUU_B                 309 SGHAFITARSQLLIDPADPFAWGIV 333 Xanthomonas campestris pv. campestris str. ATCC 33913
2AZP_A                 291 RGRAHVSAEATLLLADDDPFAWGIR 315 Pseudomonas aeruginosa
WP_010973452           306 GGWARIIGHNTIFVDDRDPLAHGFQ 330 Agrobacterium tumefaciens complex
Q8YJ29                 307 AGWARMTGYNTIFIDDRDPFAHGFS 331 Brucella melitensis bv. 1 str. 16M
Q92WS1                 307 AGWARMTGINTIFIDDRDPFAHGFV 331 Sinorhizobium meliloti 1021
PRJNA255042:J163_02380 311 AGQAWISGLSQLGLDPSDPYAEGFT 335 Xanthomonas citri pv. citri
Q988B5                 309 TGRAWITGEHSYYLDPTDPYPQGYV 333 Mesorhizobium loti
A9CH01                 310 SGRGWITGIHQHMLDPSDPWPEGYR 334 Agrobacterium fabrum str. C58
Q9I489                 310 SGRAWITGIHQYLLDPDDPWPQGYR 334 Pseudomonas aeruginosa PAO1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap