1CV8,1X9Y


Conserved Protein Domain Family
Peptidase_C47

?
pfam05543: Peptidase_C47 
Staphopain peptidase C47
Staphopains are one of four major families of proteinases secreted by the Gram-positive Staphylococcus aureus. These staphylococcal cysteine proteases are secreted as preproenzymes that are proteolytically cleaved to generate the mature enzyme.
Statistics
?
PSSM-Id: 398922
Aligned: 5 rows
Threshold Bit Score: 326.139
Threshold Setting Gi: 157830743
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1CV8_A   1 YN-EQYVNKLENFKIRETQGNNGWCAGYTMSALLNATYNTNKYHAEAVMRFLHPNLQGQQFQFTGLTPREMIYFGQTQGR 79 
Q2FZL3 220 DQ-VQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGR 298 Staphylococcus aureus...
Q2G2R8 215 YN-EQYINKLENFKIRETQGNNGWCAGYTMSELLNATYNTNKYHAEAVMRFLHPNLQGQRFQFTGLTPREMIYFGQTQGR 293 Staphylococcus aureus...
Q5HKF6 221 EMyAEYVNQLKNFRIRETQGYNSWCAGYTMSALLNATYNTNRYNAESVMRYLHPNLRGHDFQFTGLTSNEMLRFGRSQGR 300 Staphylococcus epider...
1X9Y_A 186 DQ-VQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGR 264
1CV8_A  80 SPQLLNRMTTYNEVDNLTKNNKGIAILGSRV-ESRNGMHAGHAMAVVGNAKLnNGQEVIIIWNPWDNGFMTQDAKNNVIP 158
Q2FZL3 299 DIHYQEGVPSYEQVDQLTKDNVGIMILAQSVsQNPNDPHLGHALAVVGNAKI-NDQEKLIYWNPWDTELSIQDADSSLLH 377 Staphylococcus aureus...
Q2G2R8 294 SPQLLNRMTTYNEVDNLTKNNKGIAVLGSRV-ESRNGMHAGHAMAVVGNAKLdNGQEVIIIWNPWDNGFMTQDAKNNVIP 372 Staphylococcus aureus...
Q5HKF6 301 NTQYLNRMTSYNEVDQLTTNNQGIAVLGKRV-ESSDGIHAGHAMAVAGNAKVnNGQKVILIWNPWDNGLMTQDAHSNIIP 379 Staphylococcus epider...
1X9Y_A 265 DIHYQEGVPSYNQVDQLTKDNVGIMILAQSVsQNPNDPHLGHALAVVGNAKI-NDQEKLIYWNPWDTELSIQDADSSLLH 343
1CV8_A 159 VSNGDHYQWYSSIYGY 174
Q2FZL3 378 LSFNRDYNWYGSMIGY 393 Staphylococcus aureus subsp. aureus NCTC 8325
Q2G2R8 373 VSNGDHYRWYSSIYGY 388 Staphylococcus aureus subsp. aureus NCTC 8325
Q5HKF6 380 VSNGDHYEWYASIYGY 395 Staphylococcus epidermidis RP62A
1X9Y_A 344 LSFNRDYNWYGSMIGY 359
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap