Conserved Protein Domain Family
Bap31

?
pfam05529: Bap31 
B-cell receptor-associated protein 31-like
Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8. Bap31 is cleaved within its cytosolic domain, generating pro-apoptotic p20 Bap31.
Statistics
?
PSSM-Id: 398917
Aligned: 72 rows
Threshold Bit Score: 114.896
Threshold Setting Gi: 354547748
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_011111454   1 MTLYYSLVFALLMFEMGIFLVLILPLPLTWRRQMFTFISTNPLIAKLQYGLKITFIFILILFIDSVNRVYRVQRELSDAa 80  Dactylellina ha...
EGW30645       1 MSLQMSLVFCTMIAQMIILLVLVLPLPQVVRQQIVSLAQVCQNSQNFKVGVIFSLMLMTLQFLDCLKRLHRYSGAVDNPy 80  Spathaspora pas...
Q6BPT4         1 MSIQMSLVFGALILEMVTLLLMVLPLPHPVRVKIMDIATVLRNLKNFKIGFWFTVILLSMQFADCIQRLQRFGTLGNPYf 80  Debaryomyces ha...
XP_001484271   1 MSLQMSLIFAALCGEMITLFSLVCPIPHPVRVRMMHAIEVLRTLNNFKIGVIFTTILLGMQFMDCINRLKKFLELGNPYf 80  Meyerozyma guil...
Q59UQ1         1 MSLQMSLVFCTLIGQMITLLVLVLPLPYVVRQKIVDLTFVLQKSQNFRVGIVFSIILMSLQLLDCIQRLNKYADAETNP- 79  Candida albicans
CCE44483       1 MSLQMSLVFGTMIFQMITLLLFVLPLPLMVRSQIVTLYTKITTAQNFRIFLMFSITLMSLQFYDCIQRLEKYRRVQEND- 79  Candida parapsi...
ABN66608       1 MALYYNLVFALLAAEMAFFAILSLPFPRAIRRRVLLTVSAPFKNEQFQIAIKCILGFVLILFIDSVNRVYSVTNELHNSn 80  Scheffersomyces...
XP_007374688   1 MALYYSIVFGLLVTEMVFFGILSLPYPRAIRRKVLTTVSLPFRNEQFQIALKCVLGFVAVLFIDSVNRVYAVTMELQHAg 80  Spathaspora pas...
XP_004196613   1 MALYYNLVFGLLVIEVGFFTVLSLPFPRQVRRKVLSTASAPFRNEQFQIAIKCILGFVLVLFIDSVNRLVAVTRELQSKp 80  Pichia farinosa...
XP_006683861   1 MALYYNLVFGLLVVEVAFFTVLSLPYPRKIRRTVLTTVSAPFRNEKFQIALKCILGFVLVLFIDSVNRVASVSNELQGSa 80  Yamadazyma tenu...
XP_011111454  81 qaatgnrggaaAILGHERTEVQARKFYSQRNMYLCGFTLFLSLILNRTYVLILDILRLEEEVKLG 145 Dactylellina haptotyla CBS 200.50
EGW30645      81 fds----snnhHYEHSLSYDQLASKFYAQRNLYLSGAILYLMLAIATVLAIVKKMVSKEAEYREL 141 Spathaspora passalidarum NRRL ...
Q6BPT4        81 aln-----sqnKQFGTMSYDQLASKFYSQRNLYITGAVLYLMLAIYTVSTILKKLVSKEAEFRQL 140 Debaryomyces hansenii
XP_001484271  81 gsfs---ttnqQIAGSLTSGQLASKFYAQRNLYLTGAVLYLELAIWVVVGIVEKLVAKETQLRVL 142 Meyerozyma guilliermondii ATCC...
Q59UQ1        80 ------------HFPGIDYDRLASKFYSQRNLYLSGAVLYLQVAIGTVVTIVRKMVLKEKLYREA 132 Candida albicans
CCE44483      80 -----------VLQGFVNYDKLASKFYSQRNLYLSGAILYLLMGIYTVASIVKKLVLKEKLYREL 133 Candida parapsilosis
ABN66608      81 viqngg---iqpgilnDRSEVQARRFYAQRNMYLCGFTLFLTLILTRTYGLVAELIATKDKLDSY 142 Scheffersomyces stipitis CBS 6054
XP_007374688  81 ghhgqh---ggaavvnDRGEVQARRFYAQRNMYLCGFTLFLHLILIRTYSLVAELIATKDKLDDL 142 Spathaspora passalidarum NRRL ...
XP_004196613  81 seskv------tgiinDRAEVQARRFYAQRNMYLCGFTLFLTLILMRTYSLVGELILTKDKLDNA 139 Pichia farinosa CBS 7064
XP_006683861  81 irgs--------aivnDRSEIQARRFYAQRNMYLCGFTLFLTLILLRTYSLVTELLVTKDKVDAL 137 Yamadazyma tenuis ATCC 10573
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap