Conserved Protein Domain Family
DMAP1

?
pfam05499: DMAP1 
DNA methyltransferase 1-associated protein 1 (DMAP1)
DNA methylation can contribute to transcriptional silencing through several transcriptionally repressive complexes, which include methyl-CpG binding domain proteins (MBDs) and histone deacetylases (HDACs). The chief enzyme that maintains mammalian DNA methylation, DNMT1, can also establish a repressive transcription complex. The non-catalytic amino terminus of DNMT1 binds to HDAC2 and DMAP1 (for DNMT1 associated protein), and can mediate transcriptional repression. DMAP1 has intrinsic transcription repressive activity, and binds to the transcriptional co-repressor TSG101. DMAP1 is targeted to replication foci through interaction with the far N-terminus of DNMT1 throughout S phase, whereas HDAC2 joins DNMT1 and DMAP1 only during late S phase, providing a platform for how histones may become deacetylated in heterochromatin following replication.
Statistics
?
PSSM-Id: 398903
Aligned: 24 rows
Threshold Bit Score: 194.811
Threshold Setting Gi: 196011106
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015789967 239 EEQKLLEELRKIEMRKKEREKKTQDLQKLIAAADKN-----------SDGskadtpganknpgpgrpgpgRGRKKTS--- 304 two-spotted spi...
XP_003144340 236 EEEMLIAELKKIEVRKRERERKAQDLQKLITAGERT-----------PAS--------------------PSTSTASvvp 284 eye worm
CAP28526     224 EEEDLIAEMRRIDQRKKEREKKAHDLQKLINMSEQP----------------------------------ASPSTAGfsg 269 Caenorhabditis ...
EKC31208     246 EEEHLIAELKKIELRKKEREKKTQDLQKLITAADSN-----------FDA--------------------RRSEKKQ--- 291 Pacific oyster
ESO12570     239 EEERLVQELKKIEQRKKEREKKAMDLQKLITAADNN-----------SDS--------------------RRSERKI--- 284 Helobdella robusta
XP_008184506 238 EEQMLIQEMRKIEARKRDRDRKTQDLQKLISAVDKQ-----------NDS--------------------RKSLKID--- 283 pea aphid
XP_004926554 242 EEQMLLAELKKIEARKRERERKTQDLQKLISRADSGtitpstptnhnTEPpgtpss---------maanmRRHDRKL--- 309 domestic silkworm
XP_001997784   3 EEQMLINEMKKIEARKKERERKTQDLQKLISQADQQ-----------NEHaast-------------pstRKYEKKL--- 55  Drosophila grim...
XP_011139450 233 EEQTLLAELRKIEQRKKERDRKTQDLQKLITAADHQ-----------ADP--------------------RKSERKS--- 278 Jerdon's jumpin...
XP_002115417 299 EEEMLMVELKAIEAQRKERVKGQEGLVRLMTANEKK------------EAkhpp-------------sgrKSAKKKS--- 350 Trichoplax adha...
XP_015789967 305 --HLKLNAVGKGSDPSTPNAtnv------leSVGIKFPEIKSSGVSLRSHKMKLPGSVGTKKAKAIEQLLIELNVDlKPM 376 two-spotted spi...
XP_003144340 285 ssNMKKSHKSRLLKTASISNpsisa-syiqdHSNLRFPEFRSAGAHLRSQEMKLPTNIGQKKLKNIETVIEKLKLDlVPF 363 eye worm
CAP28526     270 aaAGKRNKQFRTKAGSISMApgplfnpldisVTALRFSEFKSSGVHMRGQEMKLPTNIGQKKLKNIEVVLEKCKMEmNPV 349 Caenorhabditis ...
EKC31208     292 --TKKKIHTPHQKINPTVSTp---------ePSGIKFADFKTSGVSLRSQRMKLPASIGQKKLKAIEQVLEELGIEySPI 360 Pacific oyster
ESO12570     285 ---SKKIVPYKTRESNVAPE-----------STSIKFPDFKQSGVYLRSQKMKLPISLGQKKTKAIEQMLEEFAIEpNPV 350 Helobdella robusta
XP_008184506 284 ---KKTTHHRKRVTVPVRPTrvdp---nnfeATTIKFPDIKNSGVSTRSQRMKIPANVSQKKVKNVEQALESLKIKlNPI 357 pea aphid
XP_004926554 310 --HKKKITTQQRPMRAVENVtv--------eWSGIKFPEARGTGVWLRSQRMKLPPGVGQRKTKAIEQELRLMNIDiAPT 379 domestic silkworm
XP_001997784  56 --HKKKV-HHQPRPSKVDSVvnai----eigSSGIKFADLRGSGVSLRSQKMKLPANIGQRKVKALEQAIQEFKVDpGPP 128 Drosophila grim...
XP_011139450 279 ---SKKNSNSRNRPNKTDTSha-------veSTGIKFPDFKNSGVTLRSQRIKLPSSLGQKKMKGIEQMLNELRLElNPP 348 Jerdon's jumpin...
XP_002115417 351 --LKKKGDHNQSSTD----------------TAIIKFPE-KSSGVWLRSSRMKLPLSIGQKKTKAVEQFLSEYDLPpAPM 411 Trichoplax adha...
XP_015789967 377 PTEEICQHFNELRSDMVLLYELKMALASSEFELQTLKHQFEAL 419 two-spotted spider mite
XP_003144340 364 GVADIVKGYNEFRARIVLLQELKHSLHSAEFELESLRTRYNAL 406 eye worm
CAP28526     350 ASESIMKVYNDFRSQIMLAQELKSAMQTAEFELESLRTKLQeq 392 Caenorhabditis briggsae
EKC31208     361 PTEDTVTHFNELRQDIVLLYELKIALATCDYELESLKHRFETL 403 Pacific oyster
ESO12570     351 PTQEIVNSFNDLRQDMVLLYELKIALANSEYELQTLRHRYETL 393 Helobdella robusta
XP_008184506 358 PTEDICQNYNDLRNEIVLLNELKAACSSSDFELQTLKHQYETL 400 pea aphid
XP_004926554 380 PTEPICKHFNELRSDLALSIDLKNALASCEFELQALRHQYEAL 422 domestic silkworm
XP_001997784 129 PTEDICTSFNELRSDMVLLCELRTALSTCIYEMESLKHQYEAA 171 Drosophila grimshawi
XP_011139450 349 PTEQICQQFNELRSDIVLHYELRSALSTCDYELQSLRHQYEAL 391 Jerdon's jumping ant
XP_002115417 412 PTEEICQAFNDLREKILLLLNLRQLADNCEYEAQTLKHKLEAI 454 Trichoplax adhaerens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap