5KGZ


Conserved Protein Domain Family
Staph_haemo

?
pfam05480: Staph_haemo 
Staphylococcus haemolytic protein
This family consists of several different short Staphylococcal proteins, it contains SLUSH A, B and C proteins as well as haemolysin and gonococcal growth inhibitor. Some strains of the coagulase-negative Staphylococcus lugdunensis produce a synergistic hemolytic activity (SLUSH), phenotypically similar to the delta-hemolysin of S. aureus. Gonococcal growth inhibitor from Staphylococcus act on the cytoplasmic membrane of the gonococcal cell causing cytoplasmic leakage and, eventually, death.
Statistics
?
PSSM-Id: 398890
Aligned: 8 rows
Threshold Bit Score: 48.1773
Threshold Setting Gi: 81672963
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5KGZ_A  1 MTGLAEAIANTVQAA--QQHDSVKLGTSIVDIVANGVGLLGKL 41 
Q5HQ21 11 IMKLFNAFKDILEAA--ITNDGTQLGASIVNIIESSVDMVNRF 51  Staphylococcus epidermidis RP62A
Q2FZA4  1 MEGLFNAIKDTVTAA--INNDGAKLGTSIVSIVENGVGLLGKL 41  Staphylococcus aureus subsp. aureus NCTC 8325
Q2FZA3  1 MTGLAEAIANTVQAA--QQHDSVKLGTSIVDIVANGVGLLGKL 41  Staphylococcus aureus subsp. aureus NCTC 8325
Q5HQ19  1 MSKLAEAIANTVKAA--QDQDWTKLGTSIVDIVESGVSVLGKI 41  Staphylococcus epidermidis RP62A
Q5HKE6  4 VSKLAEAIANTVSAA--QAEDGAELAKSIVNIVANAGGIIQDI 44  Staphylococcus epidermidis RP62A
Q5HQ20  1 MEQLFDAIRSVVDAG--INQDWSQLASGIAGIVENGISVISKL 41  Staphylococcus epidermidis RP62A
Q5HKT4  1 MSGIVESLHNAVNAGlhVKQDWVDMGFGIADTVAKIVDQVLKF 43  Staphylococcus epidermidis RP62A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap