Conserved Protein Domain Family
Prominin

?
pfam05478: Prominin 
Prominin
The prominins are an emerging family of proteins that among the multispan membrane proteins display a novel topology. Mouse prominin and human prominin (mouse)-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration.
Statistics
?
PSSM-Id: 398888
Aligned: 28 rows
Threshold Bit Score: 793.362
Threshold Setting Gi: 158294624
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:AAQB:GK12310-PA  105 TTHEQQGQVHWPPVEFTPYKSKANYTKDTWSSSTAMSPIYNFTHFLYDSILTYepALPPGYIVIKDKdtlalgpkveqND 184  Drosop...
XP_002046099          57 TAHEKLGQLHFSTAEFTEYKSKANYTKEPKYSTKAMDPVYNFTRYFFGFILPDeaAIPPGYVVVKDGnylalgpkvenND 136  Drosop...
XP_002046100          53 TTHEQLGQQHYPSADLTVYKSKIRYTIELNRTSWNIKPAFNLSQFFFDHTITDtpSLPRGYLAVKNGdtlvmgpkvvdND 132  Drosop...
XP_002025591          92 TTHEQVGQVHFPKPIYTKFNGFFNYSRDLSSTTKAVNPIYNFTHFIFGTVMTDepALPPGYIMVQQEkvlvlgknverNE 171  Drosop...
EDW32791              39 TTHEQLGQDHWPSVEYSPYLGFGNYSLDLTSSQKALSPVNTLTHFALRLFLSD---LPPGYVTTTANnklvlgpkvwkND 115  Drosop...
EDW31944             101 TTHEQLGQDHWPSAEYSPYRGFGRYSRELASPRKALSPINTITHFILRSFLSD---LPPGYVTSTDNnklalgpkvwkND 177  Drosop...
Q29E29                88 TTHEQMGELHWAPVDYTPYKPTVNYTRPPTAPTTAMNPIFNFTHKLYDSIISDepALPPGYIVMQ-GdslalgpkfhnAD 166  Drosop...
KPU78240             103 TTHEQLGQPHYAPVEYSAYTPTSNYTEEPGPPTSAMNSVYNFTHFLYDKIIYRnqPIPDGYIIIKNGdtlalgpkveqND 182  Drosop...
FlyBase:CG7740-PF     76 TTHEQLGQPHWPPVQYTVYRPTTNYTKAPPPPTSAMNPIFNFTHFLYDKVLYRdePIPEGYIVVKNSdtlslgpkveeND 155  fruit fly
XP_023620782          18 ISEEPSSSPNSPDDLKFQLPTPTYETKDYYYTPRSIGNLFKMVHVFLYVVQPN--FFPKDIVREILQkkfelsm------ 89   little...
WGS:AAQB:GK12310-PA  185 WAALLAEYWL-ILAWVFFLLILIILIPFIAVCYCCfC-CCRRCRQGCpPCTSKQDARRRCCCGILLLLLIIGLIFGIIIA 262  Drosop...
XP_002046099         137 WRDLLTQYWM-VLIAVVILAILAVIMPIIAVCYCCfC-CCRRCKEGCpPCDSQKDARRRCCCGLLLLLLIIGILFGVIIA 214  Drosop...
XP_002046100         133 WSDLLGQYFL-LILWVIILVVLIILIPFLAVCYCCfC-CCRRCKRGCgPCDEANDKRRALICAVILALLLVFILLGAIIG 210  Drosop...
XP_002025591         172 WSLLMSRYWL-VLFFVIFLLAAIIVIPFIAVCYCCfC-CCLRCKQGCiRCMAATDRRRRMCCGICLFLLIIGLIFGLLIA 249  Drosop...
EDW32791             116 WAALLAQYWF-LLVVVISLLFCIIIIPFIGVCYCCfC-CCLRCKQN----KRSNEFRRRCLCSVCLALLVIGLMLGLFIM 189  Drosop...
EDW31944             178 WAALLAQYWF-LVVVVIILLVCIIIIPFIGVCYCCfC-CCLRCKQH----KISESFRRRRLYGVCLGLLVVSLMFCLLIM 251  Drosop...
Q29E29               167 FRDLIARYWL-VLLFILFLCVIIVVMPFVAVCYCClC-CCRRCRQGCpPCTSKQDAQRRLWCGVCLLILIVGLIFGIVIA 244  Drosop...
KPU78240             183 WRDLLRHYWL-LFIIVFVLLLLIIIVPFIAVCYCCfC-CCRRCRQGCpPCTTKQDAQRRFCCGICLLLLIIGLIFGIIIA 260  Drosop...
FlyBase:CG7740-PF    156 WRDLLAHYWM-VLIWVVILVVLIIVIPFIAVCYCCfC-CCRRCRQGCpPCTSKQDAQRRFCCGICLLILIIGLIFGIIIA 233  fruit fly
XP_023620782          90 dygkvvqYEIgIIFWAVLGLLFVILMPLAGLCFGL-CrCFNRCGGEMhQRQMRDGPFRRKYYALTLLVLCVLMSIGIIYG 168  little...
WGS:AAQB:GK12310-PA  263 FATNRMLNQGFEDTTTTIRRGSEDTCTFLRDVSNHIYHLFVYnYEEVETHLIDSLNNAHKHIFLDLADTSESS---ALSE 339  Drosop...
XP_002046099         215 FATNRLLDRGLEETTTTMRRGSQDTCTYLKDVSDHIHHLLVNnYGEMDKHLSDILTNAHTHIFLDLMDASEAN---AVYD 291  Drosop...
XP_002046100         211 YTSNRGLDRGLAETASTVRRGNEDTCRFLEDVNAHIHHIFVYnYEELEAHLTDMLNNAHHHIFLDLADTSESN---AIEH 287  Drosop...
XP_002025591         250 FVTNKFLHRGLQESMVTMRRSSEDTCTFLRNVADHIHHLLVFnFQELEMHLIEQINDAHNHIFLDLADASDSN---ALIE 326  Drosop...
EDW32791             190 FIANKFVDRGLEDSNMTMKRASRDTCTFLKDVADHIYHLLVYnYQELEAHLEDQLNNAHDHIFLDLGDTSEST---ALAE 266  Drosop...
EDW31944             252 FFANKFLDRGLADSNMTMKRAGQDHCTFLKEVADHIYHLMVYnYQELEAHLDEQLSTASNHIFLDLGDTSESN---ALIE 328  Drosop...
Q29E29               245 FVTNRLLDRGFDQATVTMKRGSDDICLFLKDVADHVHHLMVYnYEEMQTHISDELSSAHKHIFLDLADTSEST---SLGE 321  Drosop...
KPU78240             261 LVTNRMLDDGFAETTDTMQRGGQDTCTFLKDVSDHMYHLMVYnYEEFETHVTDQLNQAHKHILLDLADTSESN---SLAE 337  Drosop...
FlyBase:CG7740-PF    234 FVTNKMIDSGFAETSETMKRGSEDTCTYLKDVADHVHHLMMYnYEEMETHVLDQLTHAHRHIFLDLSDTSESN---SLAE 310  fruit fly
XP_023620782         169 FMANHYLRTHIRKARTLAESNFRDLRTLQNVTVPQINYVLDQ-YTTTKKKAVSDLDNIKTLLGGDIQEHVKLKtfpVLDD 247  little...
WGS:AAQB:GK12310-PA  340 LERILDNMPEALALMRQVDKLEKDLRFYGSQLRDGVRGLKRDINYNVAN-LCNt----qQCQNFLETSNIelIDTSKCIh 414  Drosop...
XP_002046099         292 LKRILENMEEAQKLIKEVDKLEKDLRFYGTQLRDGVRGVKRDVNYACAV-LCGn----rECLHFLKKTEIefLDNSKCLq 366  Drosop...
XP_002046100         288 LDRIFDNMKEARALMKQVVALDKDLRFYSTQLRDGVRGAKRDVNYACSN-LISn----nKCKQFLRNSELefVDTSSCLh 362  Drosop...
XP_002025591         327 LERILDSMPLAHPKMKQLEYLEKELRFYMSNLRDSIRGLKRDMTYTVTH-YCGnt--keRCYKTMAEKSVlyMDTSTCLh 403  Drosop...
EDW32791             267 MERILNNMPKALKIMLQVEALEKDIRFFGSQFRDGMRGQKRDLSYAAYA-LCHl----eKCYKFNHDMGVvtYDVSKCLh 341  Drosop...
EDW31944             329 MERILANMPRALMIMSQVDDLEKDIRLFGSQLRDGLRGQKRDLSYAAYA-LCHl----pKCYKFNHDMGIttYDVSKCLh 403  Drosop...
Q29E29               322 LERILHNMPEARQLMEQVAKMETDLRFYGAQLRDGLRGMKRDINFAVAN-LCTt----qECQTFLSSSSIelIDTSKCLh 396  Drosop...
KPU78240             338 LERILDNMPEALQLMREVEKLETDLRFYGAQLRDGVRGIKRDINFAVAN-LCQl----qACQKFLITSNIeyIDTSECLh 412  Drosop...
FlyBase:CG7740-PF    311 MERVLENMPEALELMRQVEKMEKDLRFYGSQLRDGVRGIKRDVNFAVAN-LCQl----qMCQKFLISSNIehIDSSQCLh 385  fruit fly
XP_023620782         248 VEAMAEEIRDTKVLLVSVNKNLWELKKSPEEIYRGLQDVKRDLEQSLKDpVCSvpaqraRCDSIRMSLDQ--LDNNTYL- 324  little...
WGS:AAQB:GK12310-PA  415 fDQIPNTTVYVENMAEIIQENYAIIPKMAIERLQTVNEKVRMVMSHVVPPLIRDVQAGKEIFQTQATNI--RNIIDAVLS 492  Drosop...
XP_002046099         367 fDQLPDTTYYSKAIEYIIAKNSGKTTKEVIDRLQYVGKRIKAGIDPLIPPIIRDIHNGQEQFRTQANNI--RSMIDAAIS 444  Drosop...
XP_002046100         363 lDNMPNTTLFLEGIEQIIKDDVAIIPKKALERFQDIASKIETAMNQVIPPLLHDINQGREKFRIQAANI--HRTIESVIS 440  Drosop...
XP_002025591         404 lDELPNTTVYVEAVEMIIKKRYNLIPKLALVRFNKVREKIKEQMELVGPPLKRTIATGHSIFDDRALKI--RNMIDAIIS 481  Drosop...
EDW32791             342 lDLIPNTTIFVEAMKQIIEDKLYQIPIRGMARLKKVKDIILKQMKLVLPPIFRSLTRSRIMFLNEAIEI--RDLIDSMIS 419  Drosop...
EDW31944             404 fDLIPNSTVFVEGMKKIIMDKTYLIPLSGLARLKNIKDLIVKHMALAFPPVFKSLAGARLMLLDEATGI--RDLIDSMIN 481  Drosop...
Q29E29               397 fDTIPNATLYLEGLNIVVKENYIKIPTDGLTRMENVSLKVKEQLNSVTPSMIRDLNGGRDTFRSHARRI--RNQVDAVLS 474  Drosop...
KPU78240             413 fDKMPNTSSYVKGMEDIVNGNYHLIPQAALARMQKINGKVMEHMTNIIPPITQNLGKGRATFRDTATEL--RNKVDAVIS 490  Drosop...
FlyBase:CG7740-PF    386 fDNLPNTKEFVEGMENIVASEYYAIPQRGLSRLKKVSDKVKTQLSFVVPPMMRDLTKGRTIFREHATNV--RNIVEGVLS 463  fruit fly
XP_023620782         325 -GQLRLLDNEINNVNGVLQTNLSSLVQMSYQSINNIPERVQKQTTEIPPAVKRTLNYIGLNIKMIAQKVpiQEKLSVFLD 403  little...
WGS:AAQB:GK12310-PA  493 DIHlNTLRSTKSFDDVYEKFGEDRSLVSVIVCMLILLILFVLIIALLCGCFGRRRSGYG-DDCCSKATGATCLLLAILLI 571  Drosop...
XP_002046099         445 DIHlNTVRSTKAFEDVYDKYGADRSIINVIVCSVLLIILLFLIIALICGCCGRRRRGYR-DDCCSKGTGASCLLLAMLLI 523  Drosop...
XP_002046100         441 DIHmRTLRSTESFEDVYEKFGKSRSYINALVCIFLLVIVILMAVGLICGCTR------------SKPTGATCLLMGIILI 508  Drosop...
XP_002025591         482 DIHlNTMRSTKTFDDVYEKFGTDRRTINIICITLIFIIIVFLFTSLVCGVGGYSRTHPGpSGFCSKGMAASCLLIAIILI 561  Drosop...
EDW32791             420 DIHlNTLRTARTFDDVYEKFGEDRRTINIVIFLLIFIIIVILISALVCGFLGPNRTMPGpPRVFSKGMAASCLFIAIIMI 499  Drosop...
EDW31944             482 DIHlNTLRTSRMFDDIHDKFGADRRAINIVICILIFIIIVILISALVCGCLGPSRTKPGpSGVFSKGMAASCLLLAIILI 561  Drosop...
Q29E29               475 QIHlKTSRSSRSFDDVYDKFGNNRSVISVIVCLLMIMILGILIVSLLCGCFGRRKTGYR-DDCCSKATAANCLFLAILLI 553  Drosop...
KPU78240             491 DIHlKTVRSSKSFDDIYERFGPDRSVMSLIACMLILLILFILVVALLCGCFGRRRTGYG-DDCCSKATGASCLLFAILLI 569  Drosop...
FlyBase:CG7740-PF    464 DIHiKTLHSTKSFEDVYERFGHDRNVVSLIVCLLILLVLFILIFALLCGCFGRRRTGYG-DECCSKSTGATCLLLAILLI 542  fruit fly
XP_023620782         404 SID-NFESNIYRELPRVEKYESYRWLSCLIICCFLTLIMIFYYLGLLCGVFGYKRNATPtTRGCVSNTGGTFLMVGVGVS 482  little...
WGS:AAQB:GK12310-PA  572 FCVFSFITLVGLLYFMIGLVTYQGGCAPWrdqDQNALFRQIDSV--------IDLNRYLpketn--rdndeLVVPPFRMS 641  Drosop...
XP_002046099         524 FCVFSIVVLVGLFYFVVGLATYQGACAPLrdqESNALFRQLNSI--------IDLNQYLpkse----lkseTPLPPLRIS 591  Drosop...
XP_002046100         509 FAVFSFLVLIGLFYFMVGLVTYQGACAPLrdlDKNALFRELDAV--------IDLNRIIrardegrtseveETGEELHMS 580  Drosop...
XP_002025591         562 FCVFSFITMVGVFYFMIGLVTYEGACAPTtqdEKYELFRQLDAV--------IDMNRYLrptn----pgdeWVMPPLHMS 629  Drosop...
EDW32791             500 FCVFSFITLVGLFYLIIGLITYTSACAPLkndQN--IFRYLDPV--------IDINRYMsgst-----evrEPFSTLPVS 564  Drosop...
EDW31944             562 FCVFSFITLVGLFYLMIGLITYTSACAPLkdgQN--ILRHVDPV--------IDLNRYMsgr-------sgDTQPTLPVS 624  Drosop...
Q29E29               554 FCMISFITLMGLVYFMIGLVTYQGACAPLrdvDKNGLFRQLDSM--------VDLNRYLpradd---aeplKAAPPLRMS 622  Drosop...
KPU78240             570 FCVFSFLTLIGLFYFIVGFVAYQGACAPLrdqENNAFFRQLDST--------INLNDYApav-------gdDDRPPMRMS 634  Drosop...
FlyBase:CG7740-PF    543 FCVFSFIALVGLFYFMLGMVTYQGACAPLrdqENNTLFRQLDAS--------IDLNHYLppse-----snkEVVQPLKMS 609  fruit fly
XP_023620782         483 FFFCWISMLFVVLTFVIGVNMEKLVCEPY---QNRKLFQIMDTPyllnenwkYYLSGKIl----------nNMDVNLTIE 549  little...
WGS:AAQB:GK12310-PA  642 SAIKACEANQSIFDMLRTNKIYDINDISRISVMTsheSDDSDHGPIFNEDLSTVVLLTAEERNRLNKLRNGNLSTYHSSL 721  Drosop...
XP_002046099         592 NAIRACQADQSIFKLLQENDLYDIDDLVRFKVIS-----ETPSVPISLANLDNFTILTEKDKRDLAELRGSNLSSYHSKV 666  Drosop...
XP_002046100         581 KAIKACNQNQSIFDLLKHNNIYRVEDLTSISIMSe-sKEEDKKESIFEEDLSTVYLLTSDERIKLEKAHTGNLSGYHSVL 659  Drosop...
XP_002025591         630 EAVRSCRANESIFQLLRTNNIYDINDLANIILLP----DIPEEAPVFTEDLTKLEILTESEKILLNKVRNSNLSTYHSML 705  Drosop...
EDW32791             565 EAIRACNANESVFQLLRAKNIYDIKKLLNLEVFV----DGFEDPPLFTGDLSNVELILEKEKLLLTDMREGNLSEYHSSL 640  Drosop...
EDW31944             625 DAIRACNANESIFDLLRAKKIYDINNLLNKEIFV----EDFEDPPVFTGDLTTLKLILEEEKVHLNKMRAGNLSEYHSIL 700  Drosop...
Q29E29               623 NALKMCEANQSVFDMLRANRLYDINELKRIKVMSs--EEDSDSTKIFDEDMSKTELLTKEEFGKLEAMRQGGAANYHSEL 700  Drosop...
KPU78240             635 GTIKACHANQTIFNVLRDHHVYDIRELARVKVLTe-pDDDSDSSKFFDEDLSNTVLLTDAERKDLNTVKETNLSAYHSAM 713  Drosop...
FlyBase:CG7740-PF    610 SAIKACHANQTIFDMMRQHNIYDINDLTRIKVMSh-sQENTDSIKVFDEDLSTVVLLTKEERDELKTAGESKLAKYHSSL 688  fruit fly
XP_023620782         550 QVYSDCKDNKGIYTALRLENVYNVSKHLTIEEHI---EYMNNEFAKINVNLDDI-ILKDEGKRNLLDFSDSGVEQIDYYT 625  little...
WGS:AAQB:GK12310-PA  722 YMEYLCKEFTPMDLRSLAQS-IDSMYNSLeyp-----tyaWAKIQFYNAVYSMRAFHDNFVIKLSGIVDKMRENLKKIDE 795  Drosop...
XP_002046099         667 FTDVMCTQLTPVDLPTMANQ-LKELRASLwsqw---giydWARTSLYNEAYNLQRYHDEFVEKIKSIISKMTEKLLKIDE 742  Drosop...
XP_002046100         660 YVENMCQALTP-SLPTISAA-LRKLQDDLyynsrwdsytrYGRIALLNEAYHFDMYNYEWTDKILKIMGKMKQKLLKIDD 737  Drosop...
XP_002025591         706 YDQNLCLKLSNNDLEVLANVlLEDLATDEavl------kiDGRVHSILHKYSALAYHKTFYLPVQRGIKKALKVVKEIDT 779  Drosop...
EDW32791             641 YSEHLCTKFIHTDFSIIKSK-SMAFVYEIntky---lkgwSGVIAYYLAAVDLIRYGNYFLDPLTSAVKKLLEKVKEIDK 716  Drosop...
EDW31944             701 YSEHLCTKFTHTDYSILKTK-TRAFAYEIntry---lkgfPACLAYFLASSDLAKYDKYLVVPLTNAVNKALQKVNEIDS 776  Drosop...
Q29E29               701 F-KDLCSEFTPVNLNALGEK-MYALSNSLesp-----tfgWARVSFWNEGLNAKSYYQNFIPKLTTIVEKMKSNMKRIDE 773  Drosop...
KPU78240             714 YLMNLCNQFTPMNLNALAEQ-MYKLSNDLeyp-----tygWAKVSFWNEGLNTKAFHRNFVPKLNSIVEKMRHNLMKIDE 787  Drosop...
FlyBase:CG7740-PF    689 YMPSLCTQFTPMNLNALSEQ-LYKLSNDLeyp-----aygWAKVSFWNEGLNTKAFYRNFVPKLTSLVEKMKANLKKIDE 762  fruit fly
XP_023620782         626 YLTETGKSLTKVNLLTYASG-LKEHADKLpp--------gVLKESLTRNIIKIKDIHNIKALPLELQLKELHRQIQELQQ 696  little...
WGS:AAQB:GK12310-PA  796 lilyENHDFNSSITILVAAVLRSEHFIQTRGKEYINLLGSNLTVELTEQIEDYVNMVITESNDNVGHCAPLSYIYYRGV- 874  Drosop...
XP_002046099         743 lilyNGNAFGESIKKLHESTERSEVFLRANGEQYVSGLRANLTSYIKEQVVQYIEMVVDKCHGNVGKCAPLAQVYNRSV- 821  Drosop...
XP_002046100         738 lilyENRNFTNSITVLANAVIRAENFLKGRGSHFINSLGQNLTDVVNEQVDEFIRGIMDECSRKVGRCAPLSYIYYRGV- 816  Drosop...
XP_002025591         780 lilyLNHDFGNSIEILLTAVINAENFVRKRGAEYVNNLGYNLTSAINEQVEEYINMVITEANNKVGLCQPLAYIYYEGV- 858  Drosop...
EDW32791             717 lilyDNNNFGDSFKILMDAVERSENFIRNKGNDYINHLANNLSTSVNLQIQEYVERVIREAENNVGHCKPLAYIYHQGA- 795  Drosop...
EDW31944             777 lilyDNNNFGNSIGVLMDAVQRSEDFIRYKGNNYINNLAHNLSISVNLQLQEYIERVISEVNKNVGHCKPLAYIYSQSA- 855  Drosop...
Q29E29               774 lilyENRDFNNSIRLLLKAVRESQNFIQTKGTRYINELGKNLTSTISNMIDEYISMVIDESNENVGRCEPLAYIYHQGV- 852  Drosop...
KPU78240             788 lilyENQDFATTIKILTETAIASEKFIKTRGNDYINTIIDNMTESIHENYDKYVDMVINDAEYNVGHCAPLAYIYYRGV- 866  Drosop...
FlyBase:CG7740-PF    763 lisyENHDFTNTIKILTATAINSEQFIQTRGKDYINALGGNLTNSIDQMIDDYIDMIIKEANESVGHCAPLSYIYYRGV- 841  fruit fly
XP_023620782         697 ----RGSGLKVKVTNILDALDSSQKFITNDLPSIIIEESKEYADIIVSYFQYYLNWAKVAIMEEIAACKPVATAFNSAFd 772  little...
WGS:AAQB:GK12310-PA  875 DLICHRLVDPINGFWVGVLLCSLLFIPILFVAHRLMCLYK 914  Drosophila willistoni
XP_002046099         822 DLICHRLVDPMNGFWVGVLLCGVLFLPVLFVAHRLLCLYK 861  Drosophila virilis
XP_002046100         817 DLVCYRLVDPINGFWMGILPAALLLLPLLYVAHKLMCLWK 856  Drosophila virilis
XP_002025591         859 YFVCSRLVDPINGFWLGLLLCSILLLPTLVVCHRLMCLYL 898  Drosophila persimilis
EDW32791             796 SLICERLVDPINAFWLATIFCCMLLLPVLLVAHCLMCLYS 835  Drosophila persimilis
EDW31944             856 YLICERLVDPINAFAMATLLCCMFLLPVLPVAHRLMCMYL 895  Drosophila persimilis
Q29E29               853 DLVCRSMVDPINGYWVGVLLCALLFLPILYVSHRLMCLYK 892  Drosophila pseudoobscura
KPU78240             867 DHICHRIVDPINGFWVGILLCALLLLPILFVAHKLMCLYK 906  Drosophila ananassae
FlyBase:CG7740-PF    842 DLICHRIVDPINGFWVGILLCALLFLPILFVAHRLMCLYK 881  fruit fly
XP_023620782         773 VFLCNYITKPMNLFWFGIGKATILLLPAIIIAVKLAKYYR 812  little brown bat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap