2FIO,2FIO


Conserved Protein Domain Family
Phi-29_GP4

?
pfam05464: Phi-29_GP4 
Click on image for an interactive view with Cn3D
Phi-29-like late genes activator (early protein GP4)
This family consists of phi-29-like late genes activator (or early protein GP4). This protein is thought to be a positive regulator of late transcription and may function as a sigma like component of the host RNA polymerase.
Statistics
?
PSSM-Id: 398884
Aligned: 2 rows
Threshold Bit Score: 249.272
Threshold Setting Gi: 116667146
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FIO_A   1 PKTQRGIYHNLKESEYVASNTDVTFFFSSELYLNKFLDGYQEYRKKFNKKIERVAVTPWNMDMLADITFYSEVEKRGFHA 80  Bacillus virus phi29
2FIO_A   1 PKTQRGIYHNLKESEYVASNTDVTFFFSSELYLNKFLDGYQEYRKKFNKKIERVAVTPWNMDMLADITFYSEVEKRGFHA 80  Bacillus virus phi29
2FIO_A  81 WLKGDNATWREVHVYALRIMTKPNTLDWSRIQKPRLRERRKSM 123 Bacillus virus phi29
2FIO_A  81 WLKGDNATWREVHVYALRIMTKPNTLDWSRIQKPRLRERRKSM 123 Bacillus virus phi29
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap