1VLQ,1ODS


Conserved Protein Domain Family
AXE1

?
pfam05448: AXE1 
Click on image for an interactive view with Cn3D
Acetyl xylan esterase (AXE1)
This family consists of several bacterial acetyl xylan esterase proteins. Acetyl xylan esterases are enzymes that hydrolyze the ester linkages of the acetyl groups in position 2 and/or 3 of the xylose moieties of natural acetylated xylan from hardwood. These enzymes are one of the accessory enzymes which are part of the xylanolytic system, together with xylanases, beta-xylosidases, alpha-arabinofuranosidases and methylglucuronidases; these are all required for the complete hydrolysis of xylan.
Statistics
?
PSSM-Id: 398876
Aligned: 7 rows
Threshold Bit Score: 471.498
Threshold Setting Gi: 81539232
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VLQ_H        14 AFFDLpLEELKKYRPERYEEKDFDEFWEETLAESEKFpLDPVFERXESHLKTVEAYDVTFSGYRGQRIKGWLLVPKlEEE 93  Thermotoga mari...
Q8DNU1         2 KNPAL-LEEIKTYRGRDEVPEDFDAFWDGEVKNVSTL-PSYHLEERDFHIPQVKCYELTFEGSKEGKVYARIVLPK-SEE 78  Streptococcus p...
Q8XK07         2 AILDMsLEKLYEYRGISPLPEDFDEFWDSELRELANLdIKLELKKADFESPIAECYDLYFNGINGARIYAKFMKPKeVKR 81  Clostridium per...
Q9K7N5         2 PLIDMpLTELKEYMGRNPKPDDFTEYWDRALQEMRKVnPNVELIPSDFQTTYAECFHLYFTGVRGARIHAKYVRPRhTSG 81  Bacillus halodu...
1ODS_F         2 QLFDLpLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVqAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPD-KEG 80  Bacillus subtilis
WP_012008864   2 QLFDLpLDDLKKYKPKKTARPDFSDFWKASLEELNQVeAELALEPYDYPVKGVKVYRLTYQSFGHSRIEGWYAVPD-QAG 80  Bacillus pumilus
Q9FC27         2 ALFDLpLDELHTYRSASAEPEDFDAFWSKTLAEAREHdLDARFEPVDTGLSTVRVYDVTFAGFGGHPVKAWLTLPAaAAE 81  Streptomyces co...
1VLQ_H        94 KLPCVVQYIGYNGG-RGFPHDWLFWPSXGYICFVXDTRGQGsgwlkGDTPDYPEGPVDPQYPGFXTRGILD-PRTYYYRR 171 Thermotoga mari...
Q8DNU1        79 KVPLIFHFHGYMGR-GWDWADMLGFTVAGYGVVSMDVRGQS-----GYSQDGLRSPLGNTVKGHIIRGAVEgRDHLFYKD 152 Streptococcus p...
Q8XK07        82 KMPALLEFHGYEER-SNDWSNNLHYVASGMCVAVMECRGQD-----YLKED-SCKFKSFKSKGHIVRGLVEgREKLLFKN 154 Clostridium per...
Q9K7N5        82 THPAVIHFHGYTMN-AGEWTGLLHYAALGYSVLAMDVRGQG-----GLSED-TGGVKGNTHSGHIIRGLDDnADQLLFRH 154 Bacillus halodu...
1ODS_F        81 PHPAIVKYHGYNASyDGEIHEMVNWALHGYATFGMLVRGQQ-------SSEDTSISPHGHALGWMTKGILD-KDTYYYRG 152 Bacillus subtilis
WP_012008864  81 LHPALVHFHGYNASyDGGIHDIVNWALHGYATFGMLVRGQG------GSED-KTVTPGGQALGWMTKGILS-KETYYYRG 152 Bacillus pumilus
Q9FC27        82 PLPLVVEFVGYGGG-RGLPHEHLLWASTGRAHFVMDTRGQGsawggGGGTADPVGGT-PAYPGFMTRGLDA-PENYYYRR 158 Streptomyces co...
1VLQ_H       172 VFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVD-THPYAEITNFLK- 249 Thermotoga mari...
Q8DNU1       153 VYLDIYQLVEIVASLSQVDEKRLSSYGASQGGALALVAAALNPRIQKTVAIYPFLSDFRRVIEIGNtSEAYDELFRYFKf 232 Streptococcus p...
Q8XK07       155 IFLDTAILARIVMNMEWVDEERVFATGGSQGGALALACAALENRIKGVYAYYPFLCDYKRIWVMDLgGDSYDELIRYFKf 234 Clostridium per...
Q9K7N5       155 VFLDTAQLANIVMNLPEVDEERVAVTGWSQGGALAIACAALEPKIKKVAPVYPFLSDYQRVWEMDLaEKAYDELQTYFRr 234 Bacillus halodu...
1ODS_F       153 VYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVAL-EEPYLEINSFFRr 231 Bacillus subtilis
WP_012008864 153 VYLDAVRALDVIQSFPEVDEHRIGVVGGSQGGALAVAAAALSDIPKVVVADYPYLSNFERAVDVAL-EQPYLEINSYFRr 231 Bacillus pumilus
Q9FC27       159 VFTDAVRAVEAARSHPLTDPSRTVALGASQGGGITIAVGGLVRDLAAVAPDVPFLCDFPRATTLTD-RHPYREVGLYLK- 236 Streptomyces co...
1VLQ_H       250 --THRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLXDNICPPSTVFAAYNYYAGP-KEIRIYPYNNHEGGGSFQAVEQ 326 Thermotoga mari...
Q8DNU1       233 ydPFHETEEEIMATLAYIDVKNLAHRIQGEVKMITGLDDDVCYPITQFAIYNRLTCD-KTYRIMPEYAHEAMNVFVNDQV 311 Streptococcus p...
Q8XK07       235 idPNHENEEYVFNTLGYIDIKNMAHRIKGKVNMAIGLRDDICPPSIQFAAYNNILCE-KELVLYDGGQKPYLLNL-KDKI 312 Clostridium per...
Q9K7N5       235 fdPQHRREAEIFTKLGYIDIQHLAPLVKGEVLLAVGLMDTVCPPSTQFAMYNKLTTT-KSIELYPDFAHEDLPGH-RDRI 312 Bacillus halodu...
1ODS_F       232 -nGSPETEVQAMKTLSYFDIMNLAYRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETK-KELKVYRYFGHEYIPAFQTEKL 309 Bacillus subtilis
WP_012008864 232 -nSDPAVEEKAFETLSYFDLINLAGWVNQPTLMAIGLIDQITPPSTVFAVYNHLETD-KDLKVYRYFGHEYISAF-QTEK 308 Bacillus pumilus
Q9FC27       237 --THRGRSGDALRTLSYFDGVHFAARGRAPALFSAALEDQTCPPSTVFAAFNAWTHEdKTIEVYDFNDHEGGGPYQEAAK 314 Streptomyces co...
1VLQ_H       327 VKFLKK 332 Thermotoga maritima MSB8
Q8DNU1       312 YNWLCG 317 Streptococcus pneumoniae R6
Q8XK07       313 YKWAIN 318 Clostridium perfringens
Q9K7N5       313 FQFLSD 318 Bacillus halodurans
1ODS_F       310 AFFKQH 315 Bacillus subtilis
WP_012008864 309 LAFLQK 314 Bacillus pumilus
Q9FC27       315 LRWLSR 320 Streptomyces coelicolor
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap