3PVC,3VYW,3AWI


Conserved Protein Domain Family
Methyltransf_30

?
pfam05430: Methyltransf_30 
Click on image for an interactive view with Cn3D
S-adenosyl-L-methionine-dependent methyltransferase
This family is a S-adenosyl-L-methionine (SAM)-dependent methyltransferase. It is often found in association with pfam01266, where it is responsible for catalyzing the transfer of a methyl group from S-adenosyl-L-methionine to 5-aminomethyl-2-thiouridine to form 5-methylaminomethyl-2-thiouridine.
Statistics
?
PSSM-Id: 398864
Aligned: 17 rows
Threshold Bit Score: 155.138
Threshold Setting Gi: 409107013
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3PVC_A 118 PELASFAEQLRAQWPLPLAGCHRILLADGAITLDLWFGDV-NTLLPTlddslnNQVDAWFLDGFAPAKNPDXWNEQLFNA 196 Yersinia pestis
Q9RTT4 111 EGGEGAGHPLWPQVLGMWGQAEALDEAANGARLRVKFCDVtRAELPQ------YWATALYLDGFSPTRNPEVWTPDFVAR 184 Deinococcus radiodurans
Q92UF9 116 PEIDEERQALVANWPTNPAGQVDIAFT-GQVRLTVVIGAA-LGGVSAs----pPDFDAWYLDGFAPSRNPDMWSEELMRL 189 Sinorhizobium meliloti
Q9AA58 109 PELGEAAQVLLDHWPGRARGFHRVDLPGFDAVLDLAVMDV-VEALEAw----dGLADAWFLDGFSPALNPAMWRDEVLAA 183 Caulobacter vibrioide...
Q9PN30 106 EEFKELLEQFLKFYPKAKEGIYRFYF--EDCFLDLVFEDI--AVLKEl----dFKADVWYLDGFSPNKNSQMFDENLIFE 177 Campylobacter jejuni ...
O51682 102 AKETAYFKLMLKNYSKIPKKNLKLKIT-ENVNLKILIGDA-KIKIKEi----pENVEYWFLDGFNPKKNPEMWSNEIFNL 175 Lyme disease spirochete
3VYW_C 145 EPYREIHEFLLERVP---------EYEGERLSLKVLLGDA-RKRIKEve---nFKADAVFHDAFSPYKNPELWTLDFLSL 211 Aquifex aeolicus VF5
Q8YQB4 104 HQLFDNWNYPYTDILTRLAFEQQVQTDC--LKAKLIIGDA-RNAICEvnh-lnFQADAIFLDPFSPPQCPQLWSVEFIQQ 179 Nostoc sp. PCC 7120
Q58084 133 YKEHEIIKDKVREYFLNKIG---IEYKSDYDNINLYVGDA-RKFIIKs----dKKYNVVFHDAFSPKRDPTLYTYDFLKE 204 Methanocaldococcus ja...
Q9HYF0 112 PELAPWSEALLGQYLAVHPGFQRLAFAGGRVGLTLLLGDA-LECLPQl----dARVDAWFLDGFAPAKNPDMWSPVLFAE 186 Pseudomonas aeruginos...
3PVC_A 197 XARXTRPGGTFSTFTAAGFVRRGLQQAGFN-VTKVKGFGQKREXLTGTLP 245 Yersinia pestis
Q9RTT4 185 LAGALAPGGVLTTYSAAGHVRRSLAAAGLD-VERRPGAPGKRECLRAVKP 233 Deinococcus radiodurans
Q92UF9 190 VFDRTVSGGSFATYAAAGFVRRNLAAAGFT-VERRPGFAGKREMLRGDKS 238 Sinorhizobium meliloti
Q9AA58 184 VGARSAPGARAATFTVAGAVRRGLSAAGFE-IAKRPGFGRKRERLEAWRP 232 Caulobacter vibrioides CB15
Q9PN30 178 VARLSKKNTQICTFSSASFLQKNLKKYGFR-VEKTKGF-RKREMIKAYLE 225 Campylobacter jejuni subsp. jejuni NCTC 11168 = ATC...
O51682 176 ISEKSSPKCKLSTFSSARIVKDGLKLANFKyIHIEKGFGNKRHMIKAQKN 225 Lyme disease spirochete
3VYW_C 212 IKERIDEKGYWVSYSSSLSVRKSLLTLGFK-VGSSREIGRKRKGTVASLK 260 Aquifex aeolicus VF5
Q8YQB4 180 VALCLHASGLLATYSCAAAVRTALLMAGLH-IGSTPPVGRRSPGTVAAHP 228 Nostoc sp. PCC 7120
Q58084 205 IYKRMEDNGVLISYSSAIPFRSALVDCGFV-ISEKESVGRKRGITLAYKN 253 Methanocaldococcus jannaschii DSM 2661
Q9HYF0 187 LARLSAPQATLGTFTSAGFVRRGLVEAGFA-MQRVPGYGQKREMLSGTYQ 235 Pseudomonas aeruginosa PAO1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap