Conserved Protein Domain Family
CRF-BP

?
pfam05428: CRF-BP 
Corticotropin-releasing factor binding protein (CRF-BP)
This family consists of several eukaryotic corticotropin-releasing factor binding proteins (CRF-BP or CRH-BP). Corticotropin-releasing hormone (CRH) plays multiple roles in vertebrate species. In mammals, it is the major hypothalamic releasing factor for pituitary adrenocorticotropin secretion, and is a neurotransmitter or neuromodulator at other sites in the central nervous system. In non-mammalian vertebrates, CRH not only acts as a neurotransmitter and hypophysiotropin, it also acts as a potent thyrotropin-releasing factor, allowing CRH to regulate both the adrenal and thyroid axes, especially in development. CRH-BP is thought to play an inhibitory role in which it binds CRH and other CRH-like ligands and prevents the activation of CRH receptors. There is however evidence that CRH-BP may also exhibit diverse extra and intracellular roles in a cell specific fashion and at specific times in development.
Statistics
?
PSSM-Id: 398863
Aligned: 16 rows
Threshold Bit Score: 533.525
Threshold Setting Gi: 942132560
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003216354  90 PLVLLfLAALEGESRYF--EVRGVGkeeEEEPVLMLRSEWKRELAEGQLYRRSLRCIDMLSIDGHFTFTADQPQLHCATF 167 green anole
XP_001381651  14 HFILIfLGALRGETRYL--ELREVA---EADPLLLFNTDLKRELSEEQLYHRSLRCIDMLSIEGQFTFTAEQPQLQCAAF 88  gray short-tail...
XP_006626779  10 YFFLIcLSALKGESRYL--EDNDIT---PEAVFSLLNSEIKRELSEEFVYRRPLRCIDMLAMEGQFTFTADHPQLNCAAF 84  spotted gar
XP_003451100  10 FLFLIsVSLRMGLARYI--EDNEAS----DGLYSLLSLAQKRE-SEDFIFRRPLRCLDMLATDGLFTFVASKPQLACAAF 82  Nile tilapia
Q6DG79        10 CFLLLsVTALRGHARFLdmQDNEIS---PEGLLSLLSSELKRELPEEFVYRRALRCLDMVAVEGQFTFTAERPQLNCAVF 86  zebrafish
XP_003455210  13 FFLVLcLSVLKGDSRYI--ENNEIT---KDELYSFFNSELKREIPEELMYRRPLRCLDMVAVEGQFTFTAERPQLSCAAF 87  Nile tilapia
XP_004074550  10 CFLLLsVSVLRGCCRDL--ENNEIS----DEFYSLFNPEPRRDPPDAFVYRRPLRCMDMVAVEGQFTFTAETPHLSCATF 83  Japanese medaka
XP_002940913  10 CLLLLfLAVLKGESRYI--QVREAA----EDALFLLNSDFKRELSEGQIYRRSLRCIDMLSIEGQFTFQADRPQLQCALF 83  tropical clawed...
EOB07136      10 HLVLIfLAAYKGETRYL--EVRDAG---EDEPFLLLSEDLKRELSAGQIYRRSLRCIDMLSIEGQFTFTAEQPQLHCATF 84  mallard
XP_003975106  10 llfllslssIVARSRFI--EEDDGT----DGLYSLLSMDQKRQ-SEDFIFRRPLRCLDMLATDGYFKFVASQPQLACAAF 82  torafugu
XP_003216354 168 FIGDPQEIITLDFDFINIDCQGGDFLKVFDGWILKGEKFPSSLDHPLSTLERYIDFCEVGQIKSAIRSSQNVAMIFFRIH 247 green anole
XP_001381651  89 FIGEPEEVISIQYDLVSVDCQGGDFLKVFDGWILKGEKFPSSQDHPLPMSDRYIDFCES-ENIRTFSSSQNVAMIFFRIH 167 gray short-tail...
XP_006626779  85 FIGEPHEIISIEYNSVNIDCSGGDFIKAFDGWILKGEKFPSSVDHPLPLYERYVDYCETGSMRRVVRSSQNVAMLFFRMR 164 spotted gar
XP_003451100  83 IIAEPSEVISLELSDVSIDCSAGDFIKIFDGWVLKGEKFPSNQDHPLPLYERYTDYCSSTAPGATSRSSQNVAMIFFRIH 162 Nile tilapia
Q6DG79        87 FIGEPTDVISIEYDSVNIDCRGGDFIKVFDGWVMKGEKFPSSQDHPLPLYERYTDYCETGVSRPIVRSSQNVAMLFFRLH 166 zebrafish
XP_003455210  88 FMAEPNEVISVDYDSVDIDCIGGDFITVFDGWVMKGEKFPSTHDHPLPLFERYVDYCDSGSLRKSVRSSQNVAMVFFRIH 167 Nile tilapia
XP_004074550  84 LMAEPSELISVEFGRVDIDCSGGDFITVFDGWVMKGEKFPSSQDHPLPLYERYVDYCDSAPARRSVRSSQNVAMVFFRVH 163 Japanese medaka
XP_002940913  84 IIGEPEEIIVIEYNFVNIDCLGGDILKVFDGWIIKGEKFPSSLDHPLSTVERYTDICEEGNVGSITRSSQNVAMIFFRVQ 163 tropical clawed...
EOB07136      85 FIGEPEELITIDYDFVDIDCQGGDFLKVFDGWILKGEKFPSSLDHPLPTSERYTDFCESGNMQRSVRSSQNVAMIFFRIH 164 mallard
XP_003975106  83 VIVEPDEVISLELYDVSIDCTAGDFIKIFDGWVLKGEKFPSRQDHPLPLHQRYTDYCSSEGAGATSRSSQNVAMVFFRIH 162 torafugu
XP_003216354 248 DPGNGFALTVKKKPNLFPCNVISQTPVGRFTMVIPHQHRNCSFSIIYPVMIKISDLMLGHL--NGLQLKK-PSSGCGGVG 324 green anole
XP_001381651 168 EPGNGFTITVKKNPNLFPCNVISQTPNGRFTMVIPHQHRNCSFSIIYPVVIKISDLILGHL--NGLQLKK-PSVGCGGIG 244 gray short-tail...
XP_006626779 165 TAGNGFTITVKKINNPFPCNVISQTPEGSFTMITPHQHRNCSFSIIYPVEIQIAELTLGHY--NDFQVKR-AVTGCGGAG 241 spotted gar
XP_003451100 163 SPDSGFTLAVKKLHNPFPCNIMSQSPEGSFTMVMPHQRKNCSFSIIYPVEIRLTELSLGQAksNELSPQRlAWSGCSGSG 242 Nile tilapia
Q6DG79       167 QSGSSFTVTFRKLINPFPCNVVSQTPEGSFTMIIPQQHRNCSFSIIYPVEIQIGELSLGQH--NDL--KR-SILGCAGSG 241 zebrafish
XP_003455210 168 SAGSSFTLTVRKHTNPFPCNVMSQSPEGSYTMVIPQQHRNCSFSIIYPVEISISEFSLGHY--NHLP-KR-SMPGCAESG 243 Nile tilapia
XP_004074550 164 SAGSSFTLTVRKHVNLFPCNAISQSPEGSYTMVIPQQRRNCSFSILYPVAIDISEYRLGRH--SSFP-KR-IMPGCTESE 239 Japanese medaka
XP_002940913 164 QPGHGFTLTIRKIPNLFPCNVISQSPNGRFTMIIPHQHRNCSFSIIYPVVIKIFDLTLGHF--NELQLKKpPPKGCGDAG 241 tropical clawed...
EOB07136     165 HPGNGFTVTVKKTTNLFPCNVISQTPSGRFTMVIPHQHRNCSFSIIYPVVIKISDLILGHL--NGLFLKK-PSAGCAGVG 241 mallard
XP_003975106 163 SPDSGFTLAVKKLHNPFPCNIMSQSPEGSFTMVISHERRNCSFSIIYPVEIRLLELSLGQAksNDISLQRkVWSDCSGSG 242 torafugu
XP_003216354 325 DFVELLGGNGLDPSKMFPLADLCHSFHGPAQMKVGCDNTVLRMVSSGKHINRVTFEYHQLEQHELE 390 green anole
XP_001381651 245 DFVELLGGTGLDPSKMMPFADLCYPFHGPAQLTIGCDNTVVRMVSSGKHVNRVTFEYHQLEPYDLg 310 gray short-tailed opossum
XP_006626779 242 DFVELLGGNGVDTSKMLPVADLCYSFNGPAQMKIGCDNTVVRMVSSGKFVNRVAFNYRLLDRQELE 307 spotted gar
XP_003451100 243 DYVELLGGNGVDTSKMFPVADLCFSLSGLAQMKIGCDNSVVRLVSSGNYINRVSFQYRLLEHNELP 308 Nile tilapia
Q6DG79       242 DFVELLGGNGMDTSKMFPMADLCYSFNGPAQMKVGCDNTVVRMVSSGKFVNRVSFQYRLLGHQELQ 307 zebrafish
XP_003455210 244 DFVQLLGGNGIDTSKLLPITDLCIAFTGPTHMKIGCDNTVVRMVSSGKFVNRVSFSYRLLDSQELQ 309 Nile tilapia
XP_004074550 240 DFVQLLGGNGIDTSKLLPITDICTSFTGPTHMKIGCDNTVVRMVSSGSFVSRVSFSYRALDSQELQ 305 Japanese medaka
XP_002940913 242 DFVELLGGAGLDPSKMFPLADLCHSFHGSAQMKIGCDNTVVRVVSSGNFINRVTFEYNQLDRH-LE 306 tropical clawed frog
EOB07136     242 DFVELLGGTGLDPSKMFPLADLCHSFHGSAQMKIGCDNTVLRMVSSGKHINRVTFEYYQLDLQEIE 307 mallard
XP_003975106 243 DYVELLGGNGVDTSQMFPVADLCFSLSGLAQMKIGCDNSVVRLVSSGNYVNRVSFqyrllephelp 308 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap