Conserved Protein Domain Family
DUF751

?
pfam05421: DUF751 
Protein of unknown function (DUF751)
This family contains several plant, cyanobacterial and algal proteins of unknown function. The family is exclusively found in phototrophic organisms and may therefore play a role in photosynthesis (personal obs:Moxon SJ).
Statistics
?
PSSM-Id: 398857
Aligned: 59 rows
Threshold Bit Score: 52.1948
Threshold Setting Gi: 116739733
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
dbpsupku:SYNPCC7002_A2567   4 FFENVLRYPRYMISLILGIFISVFEWLKPLfFKNKATATATIGLLVGLFAFLYFTLRAMLG 64  Synechococcus sp. PCC...
EFN54403                    1 FWGNVLRYISYFFSVLLGTAYIAVKPLIEL-MKKPTTAVLVVGGLAGLFFFVSFTVQA--- 57  Chlorella variabilis
EER88230                  130 FWDNMRRYALYVVTVSTGVAYAVLQPIVEL-LKNPVTALLIVAVLAGSGFLVSQVLNAMVG 189 sorghum
BAK06620                  248 FWDNMRRYGLYALTVSTGFAWALVQPIYEL-LRNPITAVLIILVMAGGAVLTVQVINAMAG 307 domesticated barley
XP_003529673              105 FWDNVRRYGLYALTVSTGALYTIFRPIAEL-LKNPISAIFILALFGGSIFIVSQVLSAMVG 164 soybean
EEF39495                  116 FWDNVRRYALYALTVSTGALYTILQPIVEL-LKNPISAVLVIVIFGGSFYIVSQVLSAMFG 175 castor bean
XP_009405974              113 FWDNVRRYVLYALTVSTGAIYTISQPIIEL-LKNPITAVLIVVLLAGAFYLLSQVLSAMVG 172 wild Malaysian banana
XP_002307907              129 FWENVRRYALYALTVSTGALYTIFEPIGEL-LKNPITAVLILLIFGGSFYVLSQVLSVMLG 188 black cottonwood
XP_018477666              122 FWDNVRRYGLYALTVSTGALSAVFEPIFEL-LKNPISAVLIVIILGGSFYIVSQVVSAMVG 181 radish
CBI25744                  210 FWDNVRRYALYFLTVSTGAVYTVFVPILEL-LKNPISAILVLVIFGGSLFIVSQVISAMVG 269 wine grape
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap