6TZK


Conserved Protein Domain Family
BCSC_C

?
pfam05420: BCSC_C 
Click on image for an interactive view with Cn3D
Cellulose synthase operon protein C C-terminus (BCSC_C)
This family contains the C-terminal regions of several bacterial cellulose synthase operon C (BCSC) proteins. BCSC is involved in cellulose synthesis although the exact function of this protein is unknown.
Statistics
?
PSSM-Id: 398856
Aligned: 45 rows
Threshold Bit Score: 306.446
Threshold Setting Gi: 451906326
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6TZK_A                   97 DLKAHTTM-LQVDAPY-SDGRMFFRSDFVNMNVGSfstnADGKWDDNWGTCTLqdc------------------------ 150  Esc...
WP_015829089            536 qlsiRQVPvLEASMPTgNYGELNVSLREVRLDSGT------LSRDALVGSGSSgaw------------------------ 585  Met...
Q5NNK1                  983 RLNEYAFN-AKVSTNLgSRVRGFFSVTPVYLTAGQ----PDQYAAPYFGSNPLvsnasiaa------------------- 1038 Zym...
BAI98909                778 KLREMTGG-ASLSAPV-AGGRAGIKATAVVLDSGR----PTGSGLARFGTNATpeaqgivd------------------- 832  Sph...
PRJNA213647:NX02_16125  781 qlrELTGD-AKISTGL-AGGRVSAKATAVVLDSGR----PTGSGLARFGRNGTreaegiva------------------- 835  Sph...
WP_012368622            871 NLTEISAPiAISSVPG-EDWRWQFNINPVSITSGT----ASGERANRFGSGQLqhaerfaknsdn--------------- 930  Pro...
utah:Sant_0177          919 NLTEVKAPlTISGAPV-DNARLSLTVTPVSLDAGS----SSGSANNRFGTGALqqgqrvanataaagattsttttstttg 993  Sod...
KFD00850                918 QLTEAKAPmTFAFVPF-DTSRLSIGVTPVSLSAGS----PSGTGNTRFGQGALsrgyssaaaaynaatgasitskdvqty 992  Rah...
WP_014715779            927 KLTEGRVPlQWSMVPF-GDARLELNVTPVTLSAGS----PSGDASRRFGTGAImqgkntaalghs--------------- 986  Shi...
CAX61931                917 KLTEAKAPlTWSTVPY-GDTRFDFTLTPVTLSAGS----ANSSATPRFGTQALeqgrsaqann----------------- 974  Erw...
6TZK_A                  151 ----------------------------------------------------------------------sgNRSQSDSG 160  Esc...
WP_015829089            586 ----------------------------------------------------------------------rySPTTSTTG 595  Met...
Q5NNK1                 1039 ----------------------------------------------------------------ggkamyapVKDQSASG 1054 Zym...
BAI98909                833 ----------------------------------------------------------------eqpsqladAETQHQSG 848  Sph...
PRJNA213647:NX02_16125  836 ----------------------------------------------------------------aqpsqlvnAETQRDSG 851  Sph...
WP_012368622            931 -------------------------------------------------------------hdeknkinaddAGSQRASG 949  Pro...
utah:Sant_0177          994 s-------------------------------------------dgatsttttttntstsdsinsgdyvadsSGAQKATG 1030 Sod...
KFD00850                993 lsdpnnpitttvngqsvatfdqyrtqlaaqytdqcssvssnsnaadiaacsalnssltrlngvdpttypateAGNQSATG 1072 Rah...
WP_014715779            987 ------------------------------------------------------------tygndqledapsQGSQNESG 1006 Shi...
CAX61931                975 --------------------------------------------------------------vlpsevkldsPGSQNASG 992  Erw...
6TZK_A                  161 ASVAVGWRNDVWSWDIGTTPM-GFN--VVDVVGGISYSDDIGPLG-YTVNAHRRPISSSLLAFGGQKDSPSntGKKWGGV 236  Esc...
WP_015829089            596 LEPRVSWRDDVWDIALGMTPDnGEV--SSRPTGYVAHQSMSKLAT-LTSSLYVEPVRESILSYTGMRDPYT--GKQWGRV 670  Met...
Q5NNK1                 1055 VALDAGIKIKDIRLDIGTTPI-GFR--KTNIQGGVSWSPQIIDHLtGHIFMERRPVMDSLIAYAGTVDPVM--GLTWGSV 1129 Zym...
BAI98909                849 VAVTASYVSKLLKLEAGVTPL-GFP--KEHVTGRIELTPRLSTNAtARIWADRKPVTDSIIAYAGTEDPRS--GAFWGAV 923  Sph...
PRJNA213647:NX02_16125  852 VALSAAYEHELVQGDVGITPI-GFI--KTHMTGGIAVTPRLSRYStARVWAERRAVTDSIVSYAGTYDPVS--GQMWGAV 926  Sph...
WP_012368622            950 VELGLILSDHNTRFDVGTTPL-NKD--SSTIVGGLTYSPKIGQNGqLTLTAERRAIKDSLLSYMGRTDPIT--GETWGQV 1024 Pro...
utah:Sant_0177         1031 TEVNLALKGERYKVDVGSTPL-GTDneLASWVGGVEWSPRLSNFSqLTFRAERRAVTDSLLAYVGARDAIS--GKHWGQV 1107 Sod...
KFD00850               1073 VEINAALTGDSYKADVGSTPL-GQD--LNSLVGGVQWAPKLTDFTtLRVTAERRAVTDSILSYVGTKDTYS--GKEWGQV 1147 Rah...
WP_014715779           1007 VEVGAALRGDNYKLDIGTTPL-GPD--LSSVVGGVQWSPQLTDYVkLIFTGERRAVTDSLLSYVGAFDKFT--GKHWGQV 1081 Shi...
CAX61931                993 VEVNLGLTNDNFKIDLGSTPL-GQD--LSTLVGGIQWSPKLTDYLtLILTGERRSVTDSLLSYVGVEDKLS--GKRWGRV 1067 Erw...
6TZK_A                  237 RADGVGLSLSYDKGEAnGVWASLSGDQLTGKNVEDNWRVRWMTGYYYKVINQNNR-RVT---IGLNNMIWHYDKDLSGYS 312  Esc...
WP_015829089            671 LRKGVRLNGLQQLGNNwSVSAAINLEYLDGESVETNRH----AGVFASVGKNLDLpAFSyavLGLGFNYDHYQKNLSHFT 746  Met...
Q5NNK1                 1130 MKTGGGGGLSYDVNGS-GLYAQGNYRVYNGTRVQKNHAVEANVGGYYSLLNTPTS-NFS---IGVNVNYQHYLNNQYFFS 1204 Zym...
BAI98909                924 MKSGGGLSLSYDRNGN-GVYADGSFYHYDGTAVRDNDSVEINAGGYLRAWQNARS-GVS---VGFNVNYQNYDNNQNYFT 998  Sph...
PRJNA213647:NX02_16125  927 TKTGGGVSFSYDRDGT-GVYADGSYHHYDGTAVRDNEGVQVNVGGYLRVWNDSRS-SAT---VGINANYQRFDNNQNYFT 1001 Sph...
WP_012368622           1025 TRNGAKAQYAWDDGKV-GAYIGGGYYNYQGKSVESNEEVKVWLGSYANFYKDEQQ-EVK---AGVHVDYMNFKNNQNYFS 1099 Pro...
utah:Sant_0177         1108 TRNGGSVQYAYDDGDI-GLYAGLGAYSYLGDNVKSNTGINASSGVYFRPYRADGR-ELR---SGVNLTWMAFDRNLSYFS 1182 Sod...
KFD00850               1148 TKNGGSVNLSYDDGDA-GFYAEAGYYSYLGNNVKSNKSVNANAGLYVRPFRYDDR-ELK---TGINVGYMDFDKNLSYYS 1222 Rah...
WP_014715779           1082 TRNGGSVQLSYDDGDA-GFYLGGGGWRYIGDNIQSNNSITGSAGFYLRPLRSADR-ELK---TGISLSYMDFSKNLSNFS 1156 Shi...
CAX61931               1068 TKNGGDALLSYDNGDA-GFYFGAGGYSYLGENVESNQSIMGQAGAYVRPFHDDSS-ELK---TGISMSWMDFSKNLSYYT 1142 Erw...
6TZK_A                  313 LGQGGYYSPQEYLSFAIPVMWRERTEN-WSWELGASGSWSHSRTKTMPRYP----LMNLiptd-wqeEAARQSNDGGSSQ 386  Esc...
WP_015829089            747 LGHGGYFSPERFVSIGPALDFLTRENQqFIVKGRLAFATVSIAEAASPWFPgnd---------------dgnSYASSKNN 811  Met...
Q5NNK1                 1205 FAQGGYFSPNHFISVAFPLRYTGTLGR-WKLNAELAPGYQNFYERSNYIFAnehdLQNQmnkfnlanNSLANKFPGQHHS 1283 Zym...
BAI98909                999 YGHGGYFSPQSFLSVNFPIRYWTNDGP-MSIQASVAPGYQSYDQQGEPVYPtepgAQGVldflksqnSDVRSSYDSISKT 1077 Sph...
PRJNA213647:NX02_16125 1002 IGHGGYFSPQSFFSVSFPMRYQRRTDL-LEIEASVTPGYQSFDQDAVGLYPvdvaAQAAldalkaqnDDVRAQYDSLSRT 1080 Sph...
WP_012368622           1100 LGHGGYFSPQDYVAVSLPVAYTRRFEK-GEVSLNGAIGVQSYKQKGSDYFPthayMQNAlnkrhtsdSRIKSRYEEQDET 1178 Pro...
utah:Sant_0177         1183 YGQGGYFSPQNYISLSLPVDYIQTFDD-WNLTLGGAIGYQSYNQDKSDYYPndpdMQAEmaslvangYADDAYYSGSSEH 1261 Sod...
KFD00850               1223 FGQGGYFSPQNYVSVSFPVEYTQKYDD-WDLKLSGAVGYQSYSQDKSAYFPnnpdLQKQleelvdagFGTESYYAGKTEN 1301 Rah...
WP_014715779           1157 YGHGGYFSPQNYVSVSFPVDYSQTFSN-WKMSVGGALGYQSYSQDSAPYFPgnssLQSQledyvnagQAKEAWYAGKSEN 1235 Shi...
CAX61931               1143 YGQGGYFSPQNFVAVSFPVDWSKNYDD-LKVKVGGSVGYQSYSQDRSAYFPtdpdKQAQlesyynagYATEAYYEGGSKN 1221 Erw...
6TZK_A                  387 GFGYTARALLERRVTSNWFVGTAIDIQQAKDYAPSHFLLYVRYSAA 432  Escherichia coli K-12
WP_015829089            812 GMSYTAEATGVWRINDRLQIGGALSERNAPQYRDETGMLFLRVLFE 857  Methylovorus glucosotrophus
Q5NNK1                 1284 GAGYEGRLAVSYRLSRSAVLGGEIRATTFGPYSEYRELLSIHYAMD 1329 Zymomonas mobilis
BAI98909               1078 GFGLSASGAISYRVSPNTRLGGELNINTFGEYKEFKTLIGLKqnig 1123 Sphingobium japonicum UT26S
PRJNA213647:NX02_16125 1081 GFGITAGGSAYYRVSDGTRVGGELNYNTFGQYKEFRSLLGIRQTig 1126 Sphingomonas sanxanigenens DSM 19645 ...
WP_012368622           1179 NITYRLGLDAKYYLNKESELGLSLSHDTSGDYAEDNMWLYLKYTPd 1224 Proteus mirabilis
utah:Sant_0177         1262 GVGYNVHAKGVYKINPQMSVGGQLSYDTFGDYSEGSAQLFLKYLLg 1307 Sodalis praecaptivus
KFD00850               1302 GIGWNAGVGGNYHLNKSMQIGGQVGYDTFGDYNESKAQVYFRYLMG 1347 Rahnella aquatilis CIP 78.65 = ATCC 3...
WP_014715779           1236 GTGYNLHANVDYNVNKDLTVGGKVTYDTFGDYNESAAHVYFRYMFG 1281 Shimwellia blattae
CAX61931               1222 GIGYNLHAGADYKVNKDVTIGGQLGYDTFGDYNESSAKLYFRYMLG 1267 Erwinia billingiae Eb661
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap