3IFU


Conserved Protein Domain Family
Peptidase_C31

?
pfam05410: Peptidase_C31 
Porcine arterivirus-type cysteine proteinase alpha
Corresponds to Merops family C31. These peptidases are involved in viral polyprotein processing in replication.
Statistics
?
PSSM-Id: 398853
Aligned: 4 rows
Threshold Bit Score: 210.553
Threshold Setting Gi: 262118645
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3IFU_A   57 LRWTLPRAFPTVECSPAGACWLSAIFPIARMTSGNLNFQQRMVRVAAEIYRAGQLTPTVL-KTLQVYERGCRWYPIVGPV 135 
Q04561   57 LHWKVPIGIPQVECTPSGCCWLSAVFPLARMTSGNHNFLQRLVKVADVLYRDGCLAPRHL-RELQVYERGCNWYPITGPV 135  Lelystad virus
Q8QQX0   57 LRWTLPRAFPTVECSPAGACWLSAIFPIARMTSGNLNFQQRMVRVAAEIYRAGQLTPAVL-KALQVYERGCRWYPIVGPV 135  Porcine reproductiv...
Q83017   57 LTWEAPITYPTKECRPGGLCWLSGIYPIARMTSGNHNFQARLNFVASVVYRDGKLTSKHLeEEFEVYSRGCRWYPITGPV 136  Lactate dehydrogena...
3IFU_A  136 PGVGVYANSLHVSDKPFPGATHVLTN 161 
Q04561  136 PGMGLFANSMHVSDQPFPGATHVLTN 161  Lelystad virus
Q8QQX0  136 PGVAVHANSLHVSDKPFPGATHVLTN 161  Porcine reproductive and respiratory syndrome virus
Q83017  137 PGIALYANAVHVSDEPFPGCTHVLSN 162  Lactate dehydrogenase elevating virus Plagemann
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap