2ZU2


Conserved Protein Domain Family
Peptidase_C30

?
pfam05409: Peptidase_C30 
Click on image for an interactive view with Cn3D
Coronavirus endopeptidase C30
Corresponds to Merops family C30. These peptidases are involved in viral polyprotein processing in replication.
Statistics
?
PSSM-Id: 398852
Aligned: 6 rows
Threshold Bit Score: 473.082
Threshold Setting Gi: 212681379
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2ZU2_B         29 GLWLGDIVYCPRHVIASNTTSA-IDYDHEYSIMRLHNFSII--SGTAFLGVVGATMHGVTLKIKVSQTNMHTPRHSFRTL 105  Human coronav...
P0C6V0       3362 GLWLDDKVYCPRHVICSSADMTdPDYPNLLCRVTSSDFCVM--SGRMSLTVMSYQMQGCQLVLTVTLQNPNTPKYSFGVV 3439 Murine hepati...
P0C6U8       3269 GLWLDDTVYCPRHVICTAEDMLnPNYEDLLIRKSNHSFLVQ--AGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRI 3346 Severe acute ...
Q98VG9       2932 GLWLGDEVICPRHVIASDTSRV-INYENELSSVRLHNFSIA--KNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSV 3008 Feline infect...
P0C6V3       2808 GLWLGDTIYCPRHVLGKFSG---DQWNDVLNLANNHEFEVTt-QHGVTLNVVSRRLKGAVLILQTAVANAETPKYKFIKA 2883 Avian infecti...
YP_002308496 2516 GIWLNNVVYCPRHVFGKFKG---EQWQHIASIADCRDFCVVcpTQGIQLTVQSVKMVGAILQLTVHTNNTATPDYEFVRL 2592 Thrush corona...
2ZU2_B        106 KSGEGFNILACYDGCAQGVFGVNMRTNWTIRGSFINGACGSPGYNLKNGEVEFVYMHQIELGSGSHVGSSFDGVMYGGFE 185  Human coronav...
P0C6V0       3440 KPGETFTVLAAYNGRPQGAFHVTLRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGNFYGPYR 3519 Murine hepati...
P0C6U8       3347 QPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFV 3426 Severe acute ...
Q98VG9       3009 RPGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGEMYGGYE 3088 Feline infect...
P0C6V3       2884 NCGDSFTIACAYGGTVVGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMGEFYGGYV 2963 Avian infecti...
YP_002308496 2593 TPGSSMTIACAYDGVVRNVYHVVLQTNNLIYASFLNGACGSVGYTLKGKTLCLHYMHHLEFNNQTHGGTDLHGVFYGPYV 2672 Thrush corona...
2ZU2_B        186 DQPNLQVESANQMLTVNVVAFLYAAILNG-------CTWWLKGEKLFVEHYNEWAQANGFTAMNGEDA----FSILAAKT 254  Human coronav...
P0C6V0       3520 DAQVVQLPVQDYTQTVNVVAWLYAAIFNR-------CNWFVQSDSCSLEEFNVWAMTNGFSSIKADLV----LDALASMT 3588 Murine hepati...
P0C6U8       3427 DRQTAQAAGTDTTITLNVLAWLYAAVING-------DRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVd--iLGPLSAQT 3497 Severe acute ...
Q98VG9       3089 DQPSMQLEGTNVMSSDNVVAFLYAALING-------ERWFVTNTSMTLESYNAWAKTNSFTEIVSTDA----FNMLAAKT 3157 Feline infect...
P0C6V3       2964 DEEVAQRVPPDNLVTNNIVAWLYAAIISVkessfslPKW-LESTTVSVDDYNKWAGDNGFTPFSTSTA----ITKLSAIT 3038 Avian infecti...
YP_002308496 2673 DEEIAQQQTTFQYYTDNVVAQLYAHLLTVda----sPRW-LAQAEVSETDFNAWASNNSFANFPCEPAnmsyILGLAQTS 2747 Thrush corona...
2ZU2_B        255 GVCVERLLHAIQV-LNNGFGGKQILGYSSLNDEfSINEVVKQMFGVNLQ 302  Human coronavirus 229E
P0C6V0       3589 GVTVEQVLAAIKR-LHSGFQGKQILGSCVLEDE-TPSDVYQQLAGVKLQ 3635 Murine hepatitis virus strain A59
P0C6U8       3498 GIAVLDMCAALKElLQNGMNGRTILGSTILEDEfTPFDVVRQCSGVTFQ 3546 Severe acute respiratory syndrome-related co...
Q98VG9       3158 GYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEfTPTEVIRQMYGVNLQ 3205 Feline infectious peritonitis virus (strain ...
P0C6V3       3039 GVDVCKLLRTIMV-KNSQWGGDPILGQYNFEDElTPESVFNQIGGVRLQ 3086 Avian infectious bronchitis virus (strain Be...
YP_002308496 2748 RVSIGRVLNTIIQ-LTLNRNGSLIMGKPDFECDwTPEMVYNQ-APITLQ 2794 Thrush coronavirus HKU12-600
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap