Conserved Protein Domain Family
NodS

?
pfam05401: NodS 
Nodulation protein S (NodS)
This family consists of nodulation S (NodS) proteins. The products of the rhizobial nodulation genes are involved in the biosynthesis of lipochitin oligosaccharides (LCOs), which are host-specific signal molecules required for nodule formation. NodS is an S-adenosyl-L-methionine (SAM)-dependent methyltransferase involved in N methylation of LCOs. NodS uses N-deacetylated chitooligosaccharides, the products of the NodBC proteins, as its methyl acceptors.
Statistics
?
PSSM-Id: 398848
Aligned: 4 rows
Threshold Bit Score: 326.804
Threshold Setting Gi: 585572
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8KLG2   5 TQSDNYQLLNRELAAPDPWGLDANPFERERHTQMLRLALAQGSISSALEVGCAAGAFTVQLAPHCKRLTVIDVVPQAIER 84  Rhizobium etli CFN 42
P19441  18 TQVNNYHLLHRELAAEDPWRLDANAFEQERHSQMLRLSLSQGPITNALEVGCAAGAFTEKLAPYCKRLTVIDVVPRAIAR 97  Sinorhizobium fredii ...
P26026   2 TQDENHQLLERELAVDDPWRLDTSAFEQQRYAQMLRMSRRDGDAASALEVGCAAGAFTEMLAPLCERLTVVDVMPQAIER 81  Bradyrhizobium diazoe...
Q07758  12 SPAGVKDLLRKDLDARDPWNISSCEYEQKRLHAIMELCLGGRTLGDVLEIGCAAGALTERLSIYSQSLTVVELMTEAIAK 91  Azorhizobium caulinod...
Q8KLG2  85 SRRRIRGSPHISWIVSDVQQFSPDERFDLIVVAEVLYYIGGIAEMRGAVRNLVRMLAPDGYLVFGSARDANCRRWGHVAG 164 Rhizobium etli CFN 42
P19441  98 TRQRMKESSHINWIVADVRQFSTQQLFDLIVVAEVLYYLEDVAAIRTAVHNLVSMLAPSGHMVFGSAIDANCRRWGHVAG 177 Sinorhizobium fredii ...
P26026  82 TRLRTGKWSHISWVTCDIQRFSTTEQFDLIVVAEVLYYLRDVVEMHAAIRNLVSMLAPDETLIFGSARDEICQRWGHAAG 161 Bradyrhizobium diazoe...
Q07758  92 AQERVNN-SDIIWHEQDVCQMDLNAKYDTIICTEVLYYIHEKERLRGALENIVQLLRSDGQFIFGSPRNAVCRSWGHLFG 170 Azorhizobium caulinod...
Q8KLG2 165 AETILGMLNETLLEVERLECRGESVNEDCLLACFRNpfSAS 205 Rhizobium etli CFN 42
P19441 178 AETVIAMLNETLIEVERLYCRGASVNEDCLLSRFQK--STT 216 Sinorhizobium fredii NGR234
P26026 162 AETVIALFNESLSEIERRHCCTGSASEDCLIVRFLKpgGAS 202 Bradyrhizobium diazoefficiens USDA 110
Q07758 171 AEAVLELAQSRLRIVDLRRINGGLPGQDCVIAKLTR----R 207 Azorhizobium caulinodans ORS 571
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap