Conserved Protein Domain Family
Phage_T7_Capsid

?
pfam05396: Phage_T7_Capsid 
Phage T7 capsid assembly protein
Statistics
?
PSSM-Id: 147533
View PSSM: pfam05396
Aligned: 6 rows
Threshold Bit Score: 160.014
Threshold Setting Gi: 75096802
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4TVX0    109 GKLSEGSYEALAAAGYSRQFVDSYIKGQQAIVTKFVESVVEYAGGREVFAKIQEAM-AENQSLGAAFNAAIERNDIVTIK 187 Vibriophage VP4
Q859E9    137 NQLSEASLKALEAVGYSRGFVRSFINGQEALANTYVAQIQAYAGGPEKFQAILSHLnATSKDAVASLEKAIESQDLHAIK 216 Pseudomonad phage ...
P20324    158 DGISEKSYAELEAAGYSRAFVDSYISGQEALVDQYVNQVVAFAGGQERFSAIHTHLeATNPAAAESLESAMMNRDLATVK 237 Enterobacteria pha...
YP_919011 152 DGLSEESYEELAKAGYSKSFVDSYIRGQEALVEQYVQSVMEYAGGEAQFQAIYNHLeVSNPDAAESLVSALENRDLATVK 231 Yersinia phage Berlin
Q3YJX2    141 GKLSDASYAKLQEAGYTKRFVDSFVRGQEALAEQYAAGVVRYAGGAEQFNRILSHLeSNDPSTREALEAAIVRKDIATTK 220 Enterobacteria pha...
Q6WY25    155 EELSAESYAKLAEIGYTKAFIDSYIRGQEALVEQYVNSVIEYAGGRERFDALYNHLeTHNPEAAQSLDNALTNRDLATVK 234 Enterobacteria pha...
Q4TVX0    188 ALIDSGKVTLRSKFGVKPKRDLTVSAkPaAQKPAAQKv--EPFANRQ 232 Vibriophage VP4
Q859E9    217 TIINLGMASHTKKFGKTPQRSVTKRA-P-ASPAAARKstvEGFASQR 261 Pseudomonad phage gh-1
P20324    238 AIINLAGESYTKKFGKPANRSVTKRAtP-VKPVARQK---EGFTNQA 280 Enterobacteria phage T3
YP_919011 232 AIVNLAGASRAKTFGKPAARSISKRAvP-AAPVRAKQ---SGFESQA 274 Yersinia phage Berlin
Q3YJX2    221 ALLNLAGKTLGKAVGVKPQRTITTQAkPvVAPKAPQT---EAFSSKA 264 Enterobacteria phage K1F
Q6WY25    235 AIINLAGESRAKAFGRKPTRSVTNRAiP-AKPQATKH---EGFADRS 277 Enterobacteria phage T7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap