2Y69


Conserved Protein Domain Family
COX7B

?
pfam05392: COX7B 
Cytochrome C oxidase chain VIIB
Statistics
?
PSSM-Id: 398844
Aligned: 17 rows
Threshold Bit Score: 122.897
Threshold Setting Gi: 82267556
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2Y69_K         1 MFPLAKNALSRLRVQSIQQAVARQI-HQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWRE 79 
Q0VFB5         1 MFPLMKSALA-LTGRGIQRTVSRQA-HHKAGPDFHDRYGNIILLSGAVFCSAIWSYVITQTGIAWNLSPVGKITPKEWKD 78  tropical clawed...
XP_006000301   1 MFSVARAALN-LTARGIRQVAVRRS-HHDAGPDFHDKYGNVVLASGIVFCTVVWSYVATQTGIVWNFSPVGRVTPKEWRQ 78  coelacanth
XP_006632693   1 MFRFAKTALN-LSAQGARQAAWRQC-HHKAGPDFHDKYGNILLVSGTLFCVAVWSYVATQTGITWNLSPVGKVTPKEWRE 78  spotted gar
XP_004076817   1 MYRFAKAAAN-ISSRAAQQ--VRHG--SSGQNNFHAKYGMGVLVSGTVFCTAVWAYVLTQTGIAWNLSPVGKVMPKEWRQ 75  Japanese medaka
Q4SPX5         1 MYRFAKAAVN-ISSQAARQ--VRHG--SSAPQDFHSKYGTGIMIGGAVFCTAIWSYVMTQTGITWNLSPIRKVMPKEWRE 75  spotted green p...
NP_001289075   1 MFPVARAALN-LTARGVQRTAVRQThHRMHEPNFHDKYGNLVLIGGAAVFATVWGYVFTKSGMEWGLSPVGRVTPKEWRE 79  chicken
ACH46025       1 MFPVARAAQS-LVARGIQHTAVRQA-HRKHQPTFHDKYGAMVLLGGATMFTAVWGYVFTQLKIEWGFSPVGRITPSEWRE 78  zebra finch
XP_006088516   2 MFPLARNILRSVKIRSFQQIRARQS-HKKHSPDFHDKYGDTILASGSIFCVVAWLFTATQVGIVWNLSPVGRVTPKEWND 80  little brown bat
XP_003415967  59 MFPLARKVLRSLELRSFQQMMARQS-HQKHLPDFHDKYGDAILASGATFCFVAWVFVITQIGLKWNLSPVGRITPKEWRk 137 African savanna...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap