3J3U


Conserved Protein Domain Family
MecA

?
pfam05389: MecA 
Click on image for an interactive view with Cn3D
Negative regulator of genetic competence (MecA)
This family contains several bacterial MecA proteins. The development of competence in Bacillus subtilis is regulated by growth conditions and several regulatory genes. In complex media competence development is poor, and there is little or no expression of late competence genes. Mec mutations permit competence development and late competence gene expression in complex media, bypassing the requirements for many of the competence regulatory genes. The mecA gene product acts negatively in the development of competence. Null mutations in mecA allow expression of a late competence gene comG, under conditions where it is not normally expressed, including in complex media and in cells mutant for several competence regulatory genes. Overexpression of MecA inhibits comG transcription.
Statistics
?
PSSM-Id: 398841
Aligned: 148 rows
Threshold Bit Score: 94.4328
Threshold Setting Gi: 302394736
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3J3U_3            1 MEIERINEHTVKFYMSYGDIEDRGFDREEIW-YNRERSEELFWEVMDEVHEEEEFAVEG-PLWIQVQALD-KGLEIIVT- 76  Bacillus sub...
CDE68800          1 MDFRRIDKNTVQCILSEEEMNAYGFRIEDFF-SNQEKAREFLEHLVERAEEEIGYEAHSgMVSMQIMKMPdNGIVITLSe 79  Clostridium ...
WP_022025322      1 MNFRRIDKNTVQCRMSEEEMEEYGFKIEDFF-TDQDKAREFLEQLVERAEEEVGYEVEGgVVSMQLMRMPdNSLIITFSd 79  unclassified...
CDA88439          1 MEFQRIGKNTVQCHMSVEEMQEYGFAIEDFF-TDQEKSREFLEQLVERAEEEVGYEVESgMVSMQLMKMPdESLVITFSd 79  Clostridium ...
CDE37289          1 MEFKRIDDTKFQCLLDEDDLEDNNISLDDFFrNDTKKIHGLLDVILEEAQKSIGIMMDGgVMSLQLAPQPnHTILLTISs 80  Eubacterium ...
WP_012739600      1 MEFKKIDDRKFQCRLNEEDLEDNNISLDDFFkNDTDKIHSLLEVVMEEAERNIGVTLSGeVMSLQLAPQPdHSILLTVSs 80  [Eubacterium...
jgi:Cphy_0564     1 MEFKRIDDETVRCIINEDDMKEYNIEIDDFL-KNKGKIQEFLHKIVEMAVDEVGYNPKNgLLAMQVMPLPrNRLAITFSe 79  Lachnoclostr...
CCZ03639         18 MKFRRIDEDTVRCIVSKEDMQEFGIVLEDFF-KNKSKIHDFLHEVVERAEQEVGYEPKEgLLSMQIMPISqNSIAITFTe 96  Eubacterium ...
agres:bpr_I0899   1 -----mNETTVECSIAASELHEIGLTPEAVI-NGAENTSSFFAQLNKEVGAQLDYNPETeVMMMSKNMMMdGSVRIFAV- 73  Butyrivibrio...
WP_007886243      1 MEIERLGENKIRCALSEEEIREMGYNIDEII-GNTEVTQEFMRAVVELVEEQGNISMQNiSPVVKAELLQdHSMAITFGg 79  Roseburia in...
3J3U_3           77 --KAqlskdgqklelpipedkkqepasedl---------------------------------------------dalld 109 Bacillus sub...
CDE68800         80 rdNSadgfqnmlqhihqqlaslidpeaegspaeaedelsae-----------------------laaevenaqgqdlqem 136 Clostridium ...
WP_022025322     80 qsPEgmnnmlnqirhlagsiddetaeaiveglkngeipdvddqaaiht---------senmdlfqkkntvdadkenyqkh 150 unclassified...
CDA88439         80 rsEEgiqgmmeqlhnltemigedgeltpedmenldavkkeiaaarekagdmmdiipdagqekankkgaskdtikegyakh 159 Clostridium ...
CDE37289         81 ghDEfsdmirnagkmmtdrilsdihdagsnvikkedagd---------------------------aiksapfvpvekle 133 Eubacterium ...
WP_012739600     81 gkDDlgsmlkkagesiskafskpeksnvikngdgiysdaefe---------------------tfgdsldkfavsddesd 139 [Eubacterium...
jgi:Cphy_0564    80 kgAEgmedilhqindalggdgeltpesmmsryedlssiekieafdkf----------irnliqdvtdeyeeqqykknkde 149 Lachnoclostr...
CCZ03639         97 keDGgyddminniketvadiisenevdnelqgddmied----------------------------fedeieandekedl 148 Eubacterium ...
agres:bpr_I0899  74 --KMsnediqkatdrirgaaetvlkmltqekvddiksktgrekgva------------lnevitnvtdtinriygrelep 139 Butyrivibrio...
WP_007886243     80 dsEMsfknlvdtvgqlmnqlapeklsefrqmnkeekqsaiddf-------------------lekykakhsqdakktete 140 Roseburia in...
3J3U_3          110 dfqkeeqavnqeekeqklqfVLRFGDFEDVISLSKlnvngS-------KTTLYSF--ENRYYLYVdfCNMTDEEVENQLS 180 Bacillus sub...
CDE68800        137 frpaekrkseketkllsaprIFMFESLKDLEQLSAg----Ivme-kpiSSAVYYEqeKDNYYLLLkkGRLTVKEYGLLCN 211 Clostridium ...
WP_022025322    151 mkdlakirrdkekslissakVYSFDNLDGLEQFAAd----Fytk-kniNSKLFRDqnSGTYYLLIkkGKLKMDEYQYLCR 225 unclassified...
CDA88439        160 aqemekkyiekqkkeqsaarIFRFSSLSMVESFAQs----Lsle-ktiPSKLYQEedTGMWYLMVkkGKLKLEEYIDVCE 234 Clostridium ...
CDE37289        134 eqiknklkktakqqegqmiaIYRFASMQAVEEFAQn----Cpkt-wglKNSLYKHkeQACFYYIVerTRCAQEKYQYICD 208 Eubacterium ...
WP_012739600    140 sfkrsdakktgsnvlkagtgVFRLQSFNDFEEMCAv----Sart-wgiTNALYKDetDNTYYFVLqkGRCSEEKYRSLLN 214 [Eubacterium...
jgi:Cphy_0564   150 nkskedkkgkqkqtvdsnlqLYTFATLSDVERFCVi----Lpes-waiRSTLFKNekEQLYYMVLekGRLSKVNFQFVCD 224 Lachnoclostr...
CCZ03639        149 veenftvgrdyrnmldypklMVAMPTIQGLVDYCKa----Vnin-ksiRSELYYLknKDLYCLVIdkYRLSVNDFKTITR 223 Eubacterium ...
agres:bpr_I0899 140 dipaqgaeavyqpiseyaryMMEFEALEEAERFSKv----Vqrl-pivDSVLYKY--QGRFYMLAglMTADEGIIYEMRR 212 Butyrivibrio...
WP_007886243    141 dangteqkedneifetsvpfSLEFSSLDEMLRLIRl----ApftekmpTSSLYKF--QQKYYLVMdlIHFSREELRPFAF 214 Roseburia in...
3J3U_3          181 ILLEYATE---SSISIHRLEEYGKLIISEHALETI 212 Bacillus subtilis subsp. subtilis str. 168
CDE68800        212 RLREYAEIcttQPYAEQFCKEHFETFIPKHALRVL 246 Clostridium sp. CAG:277
WP_022025322    226 RLSDYGTIcspRPYMEQYCKEHYKCLISKHAIRAL 260 unclassified Clostridium
CDA88439        235 HLGEYGVLcskQPYVDQYCKEHYRCIIPKHALKKI 269 Clostridium sp. CAG:230
CDE37289        209 LLTEYGGYvssKKETAAYIMEHCEILIENNAVNIM 243 Eubacterium sp. CAG:38
WP_012739600    215 LLMEYGEFdssKQERAAFVKEHFSVIINNNAINVV 249 [Eubacterium] eligens
jgi:Cphy_0564   225 RANEYGKFhseNQARVAYLKEHALCLIDKKAIKVM 259 Lachnoclostridium phytofermentans ISDg
CCZ03639        224 LAIEYSSNltnNKKIIAYVREQGEVIFDMSAYrfl 258 Eubacterium sp. CAG:603
agres:bpr_I0899 213 AGVEYSQMltvNSPEAMFIAEHGDCLIGEDAIVHL 247 Butyrivibrio proteoclasticus B316
WP_007886243    215 TIVEYNNCryaEVGQIAFIKEHGKCIVENEALQTL 249 Roseburia inulinivorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap