4D6U


Conserved Protein Domain Family
UCR_UQCRX_QCR9

?
pfam05365: UCR_UQCRX_QCR9 
Click on image for an interactive view with Cn3D
Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
The UQCRX/QCR9 protein is the 9/10 subunit of complex III, encoding a protein of about 7-kDa. Deletion of QCR9 results in the inability of cells to grow on grow on-fermentable carbon source n yeast.
Statistics
?
PSSM-Id: 398828
Aligned: 101 rows
Threshold Bit Score: 54.103
Threshold Setting Gi: 254573690
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4D6U_J           11 YSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKY 60  cattle
EDQ77012         13 MRLLMRKNSVYIAFIFTGAIIGERVVDYGINKVWERNNTGKRFQDIPKlg 62  Physcomitrella patens
XP_009379802     19 YRVLMRRNSVYVTFVVAGAFVGERIVDYGVHKLWDYNNEGKKYEDIPVLg 68  wild Malaysian banana
XP_015637496      8 YRVVMRRNAVYVTFVVAGAFAGERAVDYGVHKVWEMNNIGKRYEDISVLg 57  Japanese rice
XP_002877880     17 YKLIMRRNSVYVTFIIAGAFFGERAVDYGVHKLWERNNVGKRYEDISVLg 66  Arabidopsis lyrata subsp. lyrata
EDO98612         10 YQTFFKRSTVYIPMLLVGAYFSNEAIDYAVDKMWTTRNKGKLFSDIIAer 59  Chlamydomonas reinhardtii
jgi:MICPUN_59384  7 YKTFMSRSSVYVGVVIAGALVGEKVVNNGFDALWESRNKGKLYKDIVGnf 56  Micromonas commoda
jgi:OSTLU_27073   6 YKTFMSNSAVYVGVIVAGALAGEKALNYGFDRAWESSNKGKLWKDVEKRL 55  Ostreococcus lucimarinus CCE9901
XP_004345799      8 YQLAFKRNSVYITGIITGAFIFEKVFDSSMDGLFAKLNEGKSFEDLKKar 57  Capsaspora owczarzaki ATCC 30864
EKC35274          8 YRGVFRRSSTFAVAILGGAIVFETYFNEICDKWLAQHNAGKRYADMRKLY 57  Pacific oyster
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap