Conserved Protein Domain Family
PP1_inhibitor

?
pfam05361: PP1_inhibitor 
PKC-activated protein phosphatase-1 inhibitor
Contractility of vascular smooth muscle depends on phosphorylation of myosin light chains, and is modulated by hormonal control of myosin phosphatase activity. Signaling pathways activate kinases such as PKC or Rho-dependent kinases that phosphorylate the myosin phosphatase inhibitor protein called CPI-17. Phosphorylation of CPI-17 at Thr-38 enhances its inhibitory potency 1000-fold, creating a molecular switch for regulating contraction.
Statistics
?
PSSM-Id: 398826
Aligned: 5 rows
Threshold Bit Score: 192.022
Threshold Setting Gi: 55583760
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_957104      1 MAANRVGRRYNNKIHSPNRgasreAGLS---VQKRQARVTVKYNRKELQRRLDVEKWIDCGLDELYLGREDEMPEEVNID 77  zebrafish
XP_007257527  13 AEEQNGGRREEDGERLFPR-----AALS---AQKRQSRVTVKYNRKELQKRLDVETWIEEALEELYAGLEDEMPDEIDID 84  Mexican tetra
Q66KC0         1 MAANKVGKRFPNKPHSPSKtr--dSNQG---IQRRQARVTVKYDRKELQKRLDVEKWIDEQMEELYLGREVDMPDEVNID 75  tropical clawed...
O18734         1 MAAQRLGKRVLSKLQSPSRar--gPGGSpggLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGREADMPDEVNID 78  pig
XP_005991672   1 MAANKVGKRAQNKFLSPSRnr--eAGLA---VQKRQARVTVKYDRKELQKRLDVEKWIDERLEELYLGREKEMPEELNID 75  coelacanth
NP_957104     78 ELLDLQSDEERTQKLKDILHACSNNTEVFITELVKKLHGLQKQEDLHNNGIEHPQLHIFPERQGS-S 143 zebrafish
XP_007257527  85 ELLVLQSDEERVQKIQELLQTCTNSTQAFITELLQKLHGLQKQEELQNKGIGHPCLHSYPHHHGNvH 151 Mexican tetra
Q66KC0        76 DLLDLETDEDRRQSLQVILKSCTNNTEAFIRELLLRLKGLQKQTLIKKNGLEVSSEEHIVEHa---- 138 tropical clawed frog
O18734        79 ELLELESEEERSRKIQGLLKSCTNPTENFVQELLVKLRGLHKQP-----GLRQPS----PSGDGS-L 135 pig
XP_005991672  76 DLLDLASDEERSRKLKDMLHSCNSNIEEFTTELLIKLHGLPKQNVLQRNGIEHQEVEKp-------- 134 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap