6NZU,5O31


Conserved Protein Domain Family
Complex1_LYR

?
pfam05347: Complex1_LYR 
Complex 1 protein (LYR family)
Proteins in this family include an accessory subunit of the higher eukaryotic NADH dehydrogenase complex. In Saccharomyces cerevisiae, the Isd11 protein has been shown to play a role in Fe/S cluster biogenesis in mitochondria. We have named this family LYR after a highly conserved tripeptide motif close to the N-terminus of these proteins.
Statistics
?
PSSM-Id: 398816
Aligned: 172 rows
Threshold Bit Score: 33.7011
Threshold Setting Gi: 262105027
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6NZU_B     8 AQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKN--VKDPVEIQTLVNKAKRDLGV 66 
Q9Y7R1    15 NECLQVYRSLLRSCDEIQNRPLGEKLSKIVKARTRHYQN--VGNAYKAEALLKDAKKQCET 73  Schizosaccharomyces pombe 972h-
CAK43373   9 RQVLALYRTCLREAGKKPIVS--NYLAALSKAEFRKNSSvsKKDFGAIEYLLRKGQRQLEM 67  Aspergillus niger
EFW14531   8 RQVLALYRQCLREIRKKPVGS-QANFKRYARQEFQKNRDvnRKDFATIEYLLRRGQKQLEM 67  Coccidioides posadasii str. Silveira
Q6CD86    10 KEVLALYRKCIRAAHTKSPEN-APAFEQMARLSFRKYQGlnTKEFTTIEHLLRKGYRSLEI 69  Yarrowia lipolytica
CAR24425  10 REVLQMYRQCIRAAHDKPKAN-QPNFVTHIRKEFRQYQDlpRKDFSTIEHLLRVGHRRLEM 69  Lachancea thermotolerans CBS 6340
Q75BR5    10 KDVLHLYREFIRVAYTKAPEN-RPHFIGYIREEFRRHKDlpRKNFVAIEHLLRVGKKKLAL 69  Eremothecium gossypii
CAY67219   8 KEVLKLYRSCIRQAYKKPTEN-QDHWVRFVHEQFDKYRAipKRDFATIEHLLRTGHRRLEM 67  Komagataella phaffii GS115
EEQ38951   9 REVLKLYRACMRSVKTKPLDT-QDHWRSYVRAEFDKYRSlpKKSFSVIEHLLRVGARRHEM 68  Clavispora lusitaniae ATCC 42720
Q3E785    10 KEVLHLYRASIRTAHTKPKEN-QVNFVNYIHEEFGKYRNlpRKDFTTIEHLLRVGNKKIat 69  Saccharomyces cerevisiae S288C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap