3UF2


Conserved Protein Domain Family
CSF-1

?
pfam05337: CSF-1 
Click on image for an interactive view with Cn3D
Macrophage colony stimulating factor-1 (CSF-1)
Colony stimulating factor 1 (CSF-1) is a homodimeric polypeptide growth factor whose primary function is to regulate the survival, proliferation, differentiation, and function of cells of the mononuclear phagocytic lineage. This lineage includes mononuclear phagocytic precursors, blood monocytes, tissue macrophages, osteoclasts, and microglia of the brain, all of which possess cell surface receptors for CSF-1. The protein has also been linked with male fertility and mutations in the Csf-1 gene have been found to cause osteopetrosis and failure of tooth eruption. Structurally these are short-chain 4-helical cytokines.
Statistics
?
PSSM-Id: 398810
Aligned: 5 rows
Threshold Bit Score: 266.537
Threshold Setting Gi: 401871321
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3UF2_G  13 HMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLK 92  human
Q64129  41 HMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNRNATERLQELSNNLN 120 Mus sp.
Q3TLQ6  41 HMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLN 120 house mouse
O77709  41 HMIGNGHLLFLQQLIDSQMETSCQISFEFVDQEQLDDPVCYLKKAFLLVQDIMEDTMRFKDNTPNAKVIVQLQELSLRLK 120 cattle
O77710  41 HMIGNGHLLFLQQLIDSQMETSCQISFEFVDQEQLDDPVCYLKKAFLLVQDIMEDTMRFKDNTPNAKVIVQLQELSLRLK 120 cattle
3UF2_G  93 SCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS 152 human
Q64129 121 SCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSS 180 Mus sp.
Q3TLQ6 121 SCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSS 180 house mouse
O77709 121 SCFTMDYDEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNIFSKNCNNSFAKCSS 180 cattle
O77710 121 SCFTMDYDEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNIFSKNCNNSFAKCSS 180 cattle
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap