Conserved Protein Domain Family
DUF745

?
pfam05335: DUF745 
Protein of unknown function (DUF745)
This family consists of several uncharacterized Drosophila melanogaster proteins of unknown function.
Statistics
?
PSSM-Id: 398808
Aligned: 41 rows
Threshold Bit Score: 73.753
Threshold Setting Gi: 1004397916
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:AANI:GJ22753-PA  69 VPRQKASCIAMKAAQEAKAASDAQLPAAENAAHQVKMQLADKALAAANAAEAALAGKKQIVDQLESEVREGELVVQEESG 148 Drosophi...
XP_002054538         35 KINLKSTKIASNAANEATAAKDAQNCASEEASRRTMNRLADKAEQAARAAEAALNGKKQLLEQLEQSQIEADAVVEEVKK 114 Drosophi...
XP_001954582         47 KTNHKTSQMSSKAASDAKAAKDAQSCAAEAAGKQVKNMLADKAAQAAKAAEAALAGKKQLCEELTKNLSETQRVMQEVQR 126 Drosophi...
Q8MSM9               46 KTSMKASQVASKAAKDAKDAKDAQPCAAEMAGYRAREMLADRALQAAKAAEAALNGKKQLLDEYTKSLAETNRVIEEIQR 125 fruit fly
EFA07050             51 SSSAELTSLAHSSALQAKTAVRNQQTAGLQAALGAQTGYARAALEAAAAAQVALVAKQVIVQNLEKDIEHAAQQLQAEEA 130 red flou...
EFA07049             54 SSGAALTSLAHTSALQAKSAVQNQNTAGSQAAFGAKSSLAQAALGAAATAQAALVGKQVIVQGLEHQLHDAEHQLQAEIA 133 red flou...
EDW24386            120 LADNGLRSIAKGSADTAISAVASQNAAGKQASYVAKSTLAQAAAQAAGTAVAVLKGKEVLLHRLEDQSVEAHKAMENELT 199 Drosophi...
Q16IC8               55 SAGSGLRSIAQGSADQANNAVANQVAAAKQAAYVAQSTLAQAASQAAATAQAALAGKQVLLQGLEQQSLEAHQALESEIQ 134 yellow f...
EDV95758            114 SIGSGLRSIAQGSADQAHSAVANQHAAAKQAAFIAKNTLAQAASQAAATAQAALAGKQVLLQELEQQAAEAHRALSRELE 193 Drosophi...
1_pfamImport          4 SSGSGLRSIAQGSANQAHTAVTNQHAAAKQAAFIAKSTLAQAASQASATAQTALAGKQVMTQGLEKQLSESHKSLLEEIE 83 
WGS:AANI:GJ22753-PA 149 SLQASQGNCNAATQAAKQAGLQVKSLSDAVKNAQANVLNSEQAANGAQQELIEKQQLVEAAKKRVELLLRQLDGARTDFR 228 Drosophi...
XP_002054538        115 ALRHSESNIETALRVAQHIKQHLELMQNVLEESRNNLEQVLEVAANANTELQEKQMLIIDSKKRVEDLNHCMQKARADLD 194 Drosophi...
XP_001954582        127 AISASSCGAKTAKRVRDNVHRNLNAMKCLYGQMRKNVVSLRRVASNAQRDLAEKRSLLNAAKRRVEELNTCLDQGRKDLE 206 Drosophi...
Q8MSM9              126 AIAASSCSATSAKGIRDKLCTSVNIMKSMLKEMGGNLDNIRRMADSAQKEALEKRSLLKAARMRVEELHSCMCEAQKDLE 205 fruit fly
EFA07050            131 QYQQSLQAASAAQNAAQQGQQQLSAATAALAAVQQAVAQTERAAAAASTAAAGQHHMIQEAQQRLARLHEKLHAALAGLE 210 red flou...
EFA07049            134 QYQHTEHAAHAAQEAAQQAQQQVAALTAALAATQGGAQHAAKAAAEAAGAAAAQHAMIHEAKQRVAHLREELHNALAGLQ 213 red flou...
EDW24386            200 QLQQAKRSAKAAQYAAQQAINHVSVLTAALNNAQSASELAQKSASEAAAELASQIDMVAQAKTKLEHAESQAYGARLDYE 279 Drosophi...
Q16IC8              135 QLHQAKKAAKAAQHSAQQALNHVQVLTAALNNAQVAAEHAQQSAAEAAAELASQSQMVGNAKSRVESIEEQLKAARVDFE 214 yellow f...
EDV95758            194 QLKAAKVSAKLAQQTAQSAHNHISVLTAAVNNAKAVVEQAEQTASEVSNQLGSQATMVGQAKNRLEQVEEQLQQARVDFA 273 Drosophi...
1_pfamImport         84 QLNMSKKSAKIAQKTAQIAYNHVSILTAALNNAKTLAEHTEQAANEAAAILAAQSSMVGKAKINFENLQEQLNTAKIDLA 163
WGS:AANI:GJ22753-PA 229 NTQKAAERAAGAAQEAKQRA 248 Drosophila virilis
XP_002054538        195 RTEEIAKKAENAAEEAKQRI 214 Drosophila virilis
XP_001954582        207 RNRENAKKANCAAEDARQRI 226 Drosophila ananassae
Q8MSM9              206 RNKQSAKKANDAAKEAQQRI 225 fruit fly
EFA07050            211 ETKISAQKATAAAQVAQSNA 230 red flour beetle
EFA07049            214 ETEISAQKAAAAAHIAQSNA 233 red flour beetle
EDW24386            280 ETRDAAEKATLSAQEAQLNA 299 Drosophila persimilis
Q16IC8              215 ATQEAAHKAAYSAQEAQKNA 234 yellow fever mosquito
EDV95758            274 ATKESALKAASSAAAAQVNA 293 Drosophila grimshawi
1_pfamImport        164 ATKEAAIKASSAASEAQANA 183
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap