Conserved Protein Domain Family
ICEA

?
pfam05315: ICEA 
ICEA Protein
This family consists of several ICEA proteins from Helicobacter pylori. Helicobacter pylori infection causes gastritis and peptic ulcer disease, and is classified as a definite carcinogen of gastric cancer. ICEA1 is speculated to be associated with peptic ulcer disease.
Statistics
?
PSSM-Id: 398800
Aligned: 2 rows
Threshold Bit Score: 431.387
Threshold Setting Gi: 81665830
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014938123   2 TKTELFLELAKPDSNGVSRWVSVNEFIGKYKALQLGNGGSWCRASSSLAKTYTIEFDKTKTRGNSIDAIRLTGFNNSNTF 81  Riemerella anat...
Q7VHB6         4 SKIEIFLELAKPDKNGISRWVSVSEFIGEYKALALGNGGSWCRASSTLAKKYILEFDKSKSAGNAIDAIRLKGFNTQKTF 83  Helicobacter he...
WP_014938123  82 NQSIRKEIKDFYKNKNCVMLGINGNSINTKIEIDHKDGRKDNDRVSNIKTQRLEDFQPLSKAANDAKRQICKRCKETNLR 161 Riemerella anat...
Q7VHB6        84 NQAIRKDIKDFYKNQNCVMLGICGKSENTKIEIDHKDGRKNDLRISNQQTQKLEDFQPLCKAANDVKRQICKVCRETNKR 163 Helicobacter he...
WP_014938123 162 WNAKNLKGNPYSFYEGDEHYTQELGCVGCYQFDPVEYRKSSVIKISKEVTDNILKKLY 219 Riemerella anatipestifer
Q7VHB6       164 WSAKNIKGNPYAFYQGDENYTQELGCVGCYQYDPVAYRKESARKIAKEAADFITQKLY 221 Helicobacter hepaticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap