Conserved Protein Domain Family
Mito_fiss_reg

?
pfam05308: Mito_fiss_reg 
Mitochondrial fission regulator
In eukaryotes, this family of proteins induces mitochondrial fission.
Statistics
?
PSSM-Id: 398798
Aligned: 51 rows
Threshold Bit Score: 199.398
Threshold Setting Gi: 47223334
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGV96102      42 TWQNKDYGSARSIIRIIGKMLPLEPCRRPNFELIPHLNS--EEFDDYEPTVPSFADVLCVANDEEAGYLRFRHSPWKK-- 117 Chinese hamster
G3V9A7        24 LWSGKPYGSSRSIVRKIGTNLSLIQCPRVQFQLTSHATEw-SPTHPGEDVVATFADVGWVATDEGECSTRLRTEVRSKp- 101 Norway rat
Q3SZL7        23 LWSGKPYGSSRSIVRKIGTNLSLIQCPRVQFQLTSPTTEw-SSSPSGEDAVVSFADVGWVAEEEGECSTRQRIEVRSRp- 100 cattle
XP_003125653  23 LWSGKPYGSSRSIVRKIGTNLSLIQCPRVQFQLTSPTTEw-SPSNPEEDAVVSFADIGWVAKEDGECSTRRRAEVRSRq- 100 pig
XP_003759778  24 LWSGKPYGSSRSIVRKIGTNLSLIQCPRVQFQLTSHLTEw-SPNQYQGDAVASFADVGWVAREEREVSTRLRTEVGSKp- 101 Tasmanian devil
XP_008106730  23 LWSSKPYGPNRSIVRKIGTNLSLIQCPRVQFQLTSQCSEgsHFKQPREDGLVSLADVGWVAEEEGEVCTRLRSEIRPKs- 101 green anole
Q9PTD5        24 LWSSKPYGSSRSIVRKIGTNLSLIQCPRVQFQLTSQAAEgnHPHQFREDAVASFADVGWVAQEEGEVSTRLRSEVWSKta 103 chicken
XP_012427557  24 LWSSKPYGSSRSIVRKIGTNLSLIQCPRVHFQLISHVTEgnTPAQLREDAVASFADVGWIAEEESEVSTRLRSEVWTKtt 103 zebra finch
XP_011219500  24 LWSGKPYGSSRSIVRKIGSNLSLIQCPRVQFQLTSPTTEw-SPSHPREDAVVSFADVGWVAKEEGECSTRRRTEVRSRq- 101 giant panda
XP_005638079   7 LWSGKPYGSSRSIVRKIGTNLSLIQCPRVQFQLTSPTTEw-SPSHPGEDAVVSFADVGWVAKEEGECSTRRRTDIRSRq- 84  dog
EGV96102     118 -EEEEKIALFHSPKLIWDPSLPALRQNKPVKNDLPASEAAIKKIAALEDELTFLRSQIAAIVAMQELRESkeS-FCDLSD 195 Chinese hamster
G3V9A7       102 -PLENNPPCFEKPPSRHISLPNSSQDKPSPKTT-LASEEALQKISALENELAALRAQIAKIVTLQEQQSP--SaGCLDSS 177 Norway rat
Q3SZL7       101 -TLQDDLPFFEKPHSRQPSLPTLSPEEPPLQTSTLANEEALQKICALESELAALRAQIAKIVTLQEQQNL--SaGDLEST 177 cattle
XP_003125653 101 -PLQDELPFFEQPPSRQFSFPSLSPEEPQLQTTILANEEALQKICALESELAALRAQIAKIVTLQEQQNL--SaGDLDST 177 pig
XP_003759778 102 -APPDEFHFFEKPPNRHLSLPNLAPEDPEPKVTALANDEALQKINALEHELATLRAQIAKIVTLQEQQSL--TaGGLSPT 178 Tasmanian devil
XP_008106730 102 qLFCKNEDCSGRNSNEQISKKSQDKE--DSNSAMATNDKALQKISELENELASLRAQIAKIVSLQEKQNL--VaAGIDSA 177 green anole
Q9PTD5       104 qPLPGELHQPGHSLGRQDSVPNLLHEEPAPRSTVIANEEAMQKISALENELATLRAQIAKIVILQEQQNL--TaAGLSPV 181 chicken
XP_012427557 104 qPLPGEAHHSRKSPHRQTSLQSPSGEEPVPRSAVMANEEALQKISALENELASLRAQIAKIVTLQEQQNL--TtVGSSPL 181 zebra finch
XP_011219500 102 -PLQDDLPFFEKLPSRQFSLPNLSPEDPQQKTA-LANEEALQKISALENELAALRAQIAKIVTLQEQQNL--IaGDL--- 174 giant panda
XP_005638079  85 -PLQDDLPFSEKPPSRQFSLPSLSPEEPQQKTA-LANEEALQKISALENELaALRAQIAKIVTLQEQQNL--TaGDLEPT 160 dog
EGV96102     196 ep-sMEHTPSSATSglnvepdhspssvlsspPSPP--PLPqfslqpcfppMQPGSTN---RDNPATAMEKQHSGvNKV-- 267 Chinese hamster
G3V9A7       178 tpviV----VPPPP-----------------PPPPppPPL----------PP--PPLvlhPSTSALDLIKERRE-QRLsa 223 Norway rat
Q3SZL7       178 rpaaAAAPSVPPAP-----------------PLPPppPPL--------------PSPglqQSTSAIDLIKERRR-RNAsa 225 cattle
XP_003125653 178 tsvaTAPPSVPPAP-----------------PLPPppPPP----------PL--PPSgfhQNTSVIDLIKERKE-KNAra 227 pig
XP_003759778 179 tptiAPPSPAVPPP-----------------PLPPppPPP----------PL--PSSrlrQSVSAIDLIKERRE-KKTsa 228 Tasmanian devil
XP_008106730 178 asayTSALPSPSPP-----------------PPPPppPPP----------LP--PPPpfqQSTNAIDLIKERKG-KRMks 227 green anole
Q9PTD5       182 asaaVPCVPPPPPP-----------------PPPPplPPPal-----------------qQSMSAIELIRERKN-RKTns 226 chicken
XP_012427557 182 asaaVP-APPPPPP-----------------PPPPplPPP--------------PPSslhQSKSAIDLIKERKN-QKMna 228 zebra finch
XP_011219500 175 ------DPAI----------------------------------------SVTTPPSsg-----hIDLIKERRE-KKAca 202 giant panda
XP_005638079 161 tsvaAAPPSVP----------------------PPppPPP----------PL--PPSglhQSVSAIDLIKERRE-KKAca 205 dog
EGV96102     268 NGSHhSESQRVSDVPNMLDILKDMNKVKLR 297 Chinese hamster
G3V9A7       224 GKTLaKGHPKKLDMPNMLEILKDMNSVKLR 253 Norway rat
Q3SZL7       226 GKTPvKNSPKKTDLPNMLEILKDMNSVKLR 255 cattle
XP_003125653 228 GKTSvKNSPKKPAMPNMLEILKDMNSVKLR 257 pig
XP_003759778 229 GKILiENSPKKPEVPNMLEILKDMNNVKLR 258 Tasmanian devil
XP_008106730 228 GQTLlDNEPKKPEIPNMLDILKDMNNVKLR 257 green anole
Q9PTD5       227 GPIPtENGPKKPEIPNMLEILKDMNSVKLR 256 chicken
XP_012427557 229 GQNVvENGPKKPEVPNMLEILKDMNSVKLR 258 zebra finch
XP_011219500 203 GK----SSPKKPDVPNMLEILKDMNSVKLR 228 giant panda
XP_005638079 206 GKTLvKSSPKKSDMPNMLEILKDMNSVKLr 235 dog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap