4HKF


Conserved Protein Domain Family
Acetyltransf_16

?
pfam05301: Acetyltransf_16 
Click on image for an interactive view with Cn3D
GNAT acetyltransferase, Mec-17
Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch. Mec-17 is specifically required for maintaining the differentiation of the touch receptor. The family shares all the residue-motifs characteristic of Gcn5-related acetyl-transferases, though the exact unction is still unknown.
Statistics
?
PSSM-Id: 398794
Aligned: 34 rows
Threshold Bit Score: 217.827
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4HKF_A        10 NALFP----ERISVLDSN-------LSAGRKAHgrpdpLPQVTTVIDELGKASSKAQQLPAPITSAAK-LQA--NRHHLY 75  zebrafish
XP_001313312   2 RKTVLrpneEHFVVLEPKdva---------------raSFDVIDLINKLGEDSSRTQGLKHIITTYSSfSNS--DNNRLY 64  Trichomonas vag...
XP_002504713   8 AGLTP----GGVSVWTRD-------AI----VRlppdeYRAISALIDEAGARSARAQGLPAPITSTDR--LL--EDQRLY 68  Micromonas commoda
EFJ18369       8 ACLKSgpqgARVTIWDGQklgrlnpAE-----------KEDMRRVIDDMGRLSAQAQKLKVPITDYERiRL---GSQALY 73  Selaginella moe...
XP_008183583   8 KDLAE----GGIAKIDHT-------LTPLG-CEedenlQKKVAMIIDEMGKASARAQDLKMPITTAEK-LSK--SDHIIY 72  pea aphid
XP_016663138   8 GKVAT----DEVLKINNT-------LTVEG-HEenddlKNIMRLIIDEMGKASAVSQEFKVPITSANR-LVN--SDHVIY 72  pea aphid
XP_003247218   9 SNSHV----GQVLKINNT-------LTAEGYENnh-elRNNLRLIIDEIGKSSAIAQHLEFPITSAQK-LLN--SDHVIY 73  pea aphid
XP_016660281   8 SHIAH----DQIIKIDNS-------LLPVGYQKedpelQRMISNVLDKMGVASGIAQELKSPITSAEK-LMR--SDHILY 73  pea aphid
3_pfamImport   1 STLFT----NNIQRLNRAdllkygpRR-----------YWPVSQSIDTLGEMSSKFHGWKRVITKYDK-IVDhdEEQIVY 64 
Q23192         8 STIFT----DNIQRLTRTdllkygpKR-----------YWAVAQSIDCLGEMSSKFHGWKRVITMYDK-IVDhdEEQTTY 71  Caenorhabditis ...
4HKF_A        76 LL-KDGEQn-gGRGVIVGFLKVGYKKLFLLDQRGAHLETE-PLCVLDFYVTETLQRHGYGSELFDFXLKHKQVEPAQXAY 152 zebrafish
XP_001313312  65 ILyDDGNTr------PVGFIKTGYKHLYIFDVYGFQHEMT-PLCLLDFFVCNDVQRRGYGKKMYDYMLKCENVEPQQIAI 137 Trichomonas vag...
XP_002504713  69 LAcSDATRprgGPSVLVGILKVGPKRLFVAKPSGGMEEME-PCCVLDFYVHESSQRGGWGSLLFDAFLQREDRHPARLAY 147 Micromonas commoda
EFJ18369      74 LLtSSGPSk--DVILVKGLLKVGQKNLFIRKECGALVEIN-PLCVLDFYVHVSCQRIGLGRQIFDAMLVHTKKLAYQIGY 150 Selaginella moe...
XP_008183583  73 LL-SEQTNd--ETFVIVGILKMGWKKLYLFDKKGSRSEAM-VYCLLDFYIHETRQRQGYGNKLVEHMLKDNELEAKQLAI 148 pea aphid
XP_016663138  73 MM-TEHKKp--GHFAVVGFLKMGWKKLFLYDKQASRSEAR-VYCLLDFYIHESKQRKGYGIRLIQCMLQDIGLEAKHLAI 148 pea aphid
XP_003247218  74 MM-TEQNTp--ANFAVIGFLKMGWKKLFIYNKQDTCSETL-VYCMLDFYIYESKQRQGYGKRLIEYMLQDMKLHARHLVM 149 pea aphid
XP_016660281  74 LM-TEQTSp--GHFVVVGLLKMGWKKLYLFNKKGSRTEAM-VYCLLDFYIHETRQRHGYGIKLMDYMLKDNQIEARQLAV 149 pea aphid
3_pfamImport  65 ILwEKVDSt---KSLLKGLLRVGYKTLYLTDND-QNQFMEkTMCILDFFIVPSEQRKGNGYNMFEAMLKAENVSVDQCAF 140
Q23192        72 IMwEKVNGs---KSILKGLLRVGYKTLYLTDNE-QNQYMEkAMCILDFFVVPTEQRSGNGFKMFDEMLKAENVTVDQCAF 147 Caenorhabditis ...
4HKF_A       153 DRPSPKFLSFLEKRYDLRNSVPQVNNFVVFAGFF 186 zebrafish
XP_001313312 138 DRPSPLCLSFMKKHFGLSEYVPQTNNFVVFNQYF 171 Trichomonas vaginalis G3
XP_002504713 148 DRPSPKLVAFMAKHHNLRAFAKQNNNFVVFDEYW 181 Micromonas commoda
EFJ18369     151 DRPSQKLLSFLAKHYNLKRFYPQANQFVIYNAYF 184 Selaginella moellendorffii
XP_008183583 149 DKPSKKMLQFMQKHYSLKKLVDQGNNFVIFEEFF 182 pea aphid
XP_016663138 149 DKPTDKLLQFMWKHFQLSKLVNQENNFVIFEEFF 182 pea aphid
XP_003247218 150 DKPTTNLLQFMLKNFQLSKLVNQGNNFAIYEDFF 183 pea aphid
XP_016660281 150 DQPTNKLLQFLWKYFNLSKLVNQGNNFVIFEEFF 183 pea aphid
3_pfamImport 141 DKPSAALQQFFEKYYDRKEPVWQSNKYAVYPNFF 174
Q23192       148 DKPSAALQQFLEKYYDRKDLVWQSNKYALCSNFF 181 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap