4FGM


Conserved Protein Domain Family
Peptidase_M61

?
pfam05299: Peptidase_M61 
Click on image for an interactive view with Cn3D
M61 glycyl aminopeptidase
Glycyl aminopeptidase is an unusual peptidase in that it has a preference for substrates with an N-terminal glycine or alanine. These proteins are found in Bacteria and in Archaea.
Statistics
?
PSSM-Id: 398792
Aligned: 169 rows
Threshold Bit Score: 128.015
Threshold Setting Gi: 302194361
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4FGM_A         267 FLSLCCHEYFHSWNIKTLKPKAFLPYQLEKESYTEQLWFYEGXTSYFDDYLLHTSGIIDEKRYLKLLGDTLSRVERGAGQ 346 Idiomarina lo...
WP_025295467   310 sRNLLPHEFTHSWNGKYRRGADLFTPDFRTPMRNSLLWVYEGQTQFWGYVLQARSGLVSKQDTLDAYAVIAAQLDNRPAR 389 Sphingomonas ...
WP_011950957   315 RHNLLPHEYVHSWNGKYRRGADLYTPDYSVPMRNSLLWVYEGQTQYWGYVLQARSGLVSPDDTLAYLAMAAAQLDGRPGR 394 Sphingomonas ...
Q1GPK1         364 ERGLLPHELVHSWNGKYRRPDKLWTPDYRTPMQDNLLWVYEGQTSYWDLVLAGRSGMQSKETILGEWASHAANYSVQPGR 443 Sphingopyxis ...
WP_013831834   316 DRNVLPHEFTHSWNGKYRRPAKLWTPDYRTPMQDNLLWVYEGQTQFWGQVLAVRSGVQEKDTVLGAIARAAAALAANPGR 395 Novosphingobi...
ELS:G432_16745 315 rRNLLPHEFTHSWNGKFRRPAGNWTPDFNTPMNDDLLWVYEGQTQFWGYVLGARSGLFTKQETLDALAAIAANLDIRRGR 394 Sphingomonas ...
BAI94895       319 DRNLLPHEFTHSWDGKFRRPDLLWTPDFNVPMQDNLLWVYEGQTQFWGYVLGARSGLFSKQETLDAYAHIAAKLDTARGR 398 Sphingobium j...
BAK68341       318 NRDLLAHEFVHSWNGKFRRPELLWTPDFATPMQDNLLWLYEGQTQFWGYVLSARAGLLSKAETLDALAAIAARLDNVKGR 397 Sphingobium s...
jgi:Bresu_2626 318 DRDLLAHEYTHSWDGKYRRPAGQDVANFNIPMQNTLLWVYEGQTQFWGKVLAARSGLHNRQQALDALAMDAATYDNTVGR 397 Brevundimonas...
EEF25421       167 RRELLPHEFTHSWNGKFRRPAGQAVADFNTPLQNELLWVYEGQTQYWGAVLAARSGLIKPEHTRDLIAATAARYDNVKGR 246 castor bean
4FGM_A         347 YQQSVTESSFL---------AWTKFYQQnenapnsiVSYYAKGAL 382 Idiomarina loihiensis L2TR
WP_025295467   390 GWRDLEDTTNDpiisarrpkGWVSYQRS--------EDYYNEGLL 426 Sphingomonas sanxanigenens
WP_011950957   395 QWRPLIDTTNDpiiaarrpqPWTSLQRS--------EDYYNEGML 431 Sphingomonas wittichii
Q1GPK1         444 RWRSVEDTTLDpiiaarkpkPFASWSRT--------EDYYNEGSL 480 Sphingopyxis alaskensis
WP_013831834   396 GWRSVEDTTFDpvfaarkpkPYASMART--------EDYYWEGAM 432 Novosphingobium sp. PP1Y
ELS:G432_16745 395 DWRALQDTTNDpvitarspkGWVSFQRS--------EDYYNEGML 431 Sphingomonas sp. MM-1
BAI94895       399 EWRPMEDTTHDpiisarrpkGWSSWQRS--------EDYYNEGLM 435 Sphingobium japonicum UT26S
BAK68341       398 QWRPLEDTTHDpiisarrpkAWPSWQRS--------EEYYNEGLL 434 Sphingobium sp. SYK-6
jgi:Bresu_2626 398 EWRAMQDTVNDpiiqqrapiGWRAWQRS--------EDYYVEGQL 434 Brevundimonas subvibrioides ATCC 15264
EEF25421       247 DWRAVQDTVNDpiinarrpqGWNNWQRS--------EDYYSEGEL 283 castor bean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap