Conserved Protein Domain Family
Bombinin

?
pfam05298: Bombinin 
Bombinin
This family consists of Bombinin and Maximin proteins from Bombina maxima (Chinese red belly toad). Two groups of antimicrobial peptides have been isolated from skin secretions of Bombina maxima. Peptides in the first group, named maximins 1, 2, 3, 4 and 5, are structurally related to bombinin-like peptides (BLPs). Unlike BLPs, sequence variations in maximins occurred all through the molecules. In addition to the potent antimicrobial activity, cytotoxicity against tumor cells and spermicidal action of maximins, maximin 3 possessed a significant anti-HIV activity. Maximins 1 and 3 have been found to be toxic to mice. Peptides in the second group, termed maximins H1, H2, H3 and H4, are homologous with bombinin H peptides.
Statistics
?
PSSM-Id: 114046
View PSSM: pfam05298
Aligned: 3 rows
Threshold Bit Score: 254.907
Threshold Setting Gi: 68052038
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58T89     1 MNFKYIVAVSFLIASGYARSEENDVQSLSQREVLEEETLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAKGHEV 80  large-webbed bell toad
AAX50240   1 MNFKYIVAVSFLIASAYARSEENDEQSLSQRDVLEEESLREIRGIGTKIIGGLKTAVKGALKELASTYVNGKRTAEDHEV 80  large-webbed bell toad
Q4L0B6     1 MNFKYIVAVSFLIASAYARSVKNDEQSLSQRDVLEEESLREIRGIGRKFLGGVKTTFRCGVKDFASKHLYGKRTAEEHEV 80  large-webbed bell toad
Q58T89    81 MKRLEAVMRDLDSLDHPEEASERETRGFNQEEIANLFTKKEKRILGPVLSLVGSALGGLIK 141 large-webbed bell toad
AAX50240  81 MKRLEAVMRDLDSLDYPEEASERETRGFNQEEIANLFTKKEKRILGPVISTIGGVLGGLLK 141 large-webbed bell toad
Q4L0B6    81 MKRLEAIMRDLDSLDHPEEASERETRGFNQDEIANLFTKKEKRILGPVLGLVGNALGGLIK 141 large-webbed bell toad
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap