4KSF,4KSA


Conserved Protein Domain Family
MCD

?
pfam05292: MCD 
Click on image for an interactive view with Cn3D
Malonyl-CoA decarboxylase C-terminal domain
This family consists of several eukaryotic malonyl-CoA decarboxylase (MLYCD) proteins. Malonyl-CoA, in addition to being an intermediate in the de novo synthesis of fatty acids, is an inhibitor of carnitine palmitoyltransferase I, the enzyme that regulates the transfer of long-chain fatty acyl-CoA into mitochondria, where they are oxidized. After exercise, malonyl-CoA decarboxylase participates with acetyl-CoA carboxylase in regulating the concentration of malonyl-CoA in liver and adipose tissue, as well as in muscle. Malonyl-CoA decarboxylase is regulated by AMP-activated protein kinase (AMPK).
Statistics
?
PSSM-Id: 398791
Aligned: 48 rows
Threshold Bit Score: 354.94
Threshold Setting Gi: 122310669
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4KSF_A            169 GFLTLQPIDWTTPAHILEKIIKYEAVHEIAGWEELRRRLaPADRRCFAFFHPRLRDDPLVFVEVALTRSIPSAIADVLDE 248 Agrobacter...
jgi:Pden_1720     178 GFLVLRHIDWNTPASILEKIIRYEAVHAIQNWDDLRNRLqPTDRRCYGFFHPQLVDEPLIFVEVALTEEIPDNVAGLLDL 257 Paracoccus...
jgi:Mrad2831_1479 181 GFLVLRHIDWTTPAHILEKIIRYEAVHAISGWDDLRARIePPDRRCFAFFHPALADEPLIFVEVALTDQIAPAIAPILSQ 260 Methylobac...
jgi:Mnod_7252     181 GFLVLHRIDWTTPAHILEKIIRYEAVHEISGWDDLRRRIePADRRCFAFFHPALVDEPLIFVEVALTTGIASAIGPILAN 260 Methylobac...
MSU:OCAR_6806     168 GFLVLRRIDWTTSANILEKIIRYEAVHAIHDWTELRRRIePEDRRLFAFFHPQMTDEPLIFVEVALTRDIPDSIAPLLAP 247 Oligotroph...
jgi:Pnuc_0627     146 GFLKMHQVDWQSPAEILEKLIQHEAVHAIDGWDDLRRRL-QPDRRCFAFFHPQLPNEPLIFVEVALLPEIPAVITPLVDK 224 Polynucleo...
WP_013695522      164 GFLRLERITWETKAAVLEKIIKYEKVHKILDMNDLKRRL-QEDRRFFAYFHPVLADEPLIFVQVAFGDGLGKSIQDIMKP 242 Candidatus...
1_pfamImport        1 GFLNLERVTWKSPCEMLQKISEYEAVHPVRSWADLKRRV-GSYRRCFVYTHSSMPFEPIVVLHTALSTEIASSMKGIVQA 79 
EKC18395          165 GFLHLQRITWQSPCDMVQKISQYEAVHPIRDMTDLKRRV-GSYRRCFVFTHGSMPGEPVVVLHTALTGSISSSIHSILKT 243 Pacific oy...
Q20048            153 GNLKLERLTWSSPGDILQKVAEYEAVHPVRGLSDFRKRL-GPLRRCFYFSHEALPRNPLVMVHVALVDEIADSVQEITKR 231 Caenorhabd...
4KSF_A            249 SRDH-----------------IG-ADTATTAVFYSISNCQDGLRGISFGNFLIKQVVEDLRRDLPGLKEFVTLSPVPGFA 310 Agrobacter...
jgi:Pden_1720     258 DRQP-----------------IE-AERASTAVFYSISNTQRGLAGVSFGNFLIKQVVEELKAELPNIRTFVTLSPVPGFA 319 Paracoccus...
jgi:Mrad2831_1479 261 ERKP-----------------LQ-PHAATTAVFYSISNCQKGLAGVTFGNFLIKQVVEDLTREVPTLKTFVTLSPVPGFA 322 Methylobac...
jgi:Mnod_7252     261 ERQP-----------------MA-SREATTAIFYSISNCQRGLAGVTFGNFLIKQVVEDLCREMPALKTFVTLSPVPGFR 322 Methylobac...
MSU:OCAR_6806     248 DRQA-----------------IS-TTEADTAVFYSISNCQAGLRGVSFGNFLIKQVVEDLRRELPNLRTFVTLSPVPGFA 309 Oligotroph...
jgi:Pnuc_0627     225 KAET-----------------VHqSSQYKVAAFYSISNCEPGLRGVSMGNFLIKRVAEKLHAEFPGIKTFVTLSPIPGFI 287 Polynucleo...
WP_013695522      243 ITGN--------------------FEKSNTATFYSISNCQEGLMRVTLGNFLIKRVVHEIQSENSNIKNFGTLSPLPGFA 302 Candidatus...
1_pfamImport       80 TQRMse--------------iED-PNLVTAAVFYSITSTQQGLQGIELGNYLIKRVVRELQAEFPRVTQFSSLSPIPNFK 144
EKC18395          244 PTFSgrrpetdsssdgdveekEE-LSKISAAIFYSITSTQKGLQGVDLGNYLIKTVVKELQNEFSGITQFSSLSPIPGFK 322 Pacific oy...
Q20048            232 GAPT-----------------GK-EEDQTTAIYYSITSTQPGLSGIDLGNMLIKKVATKLQKDVPSVTTHSTLSPIPGFR 293 Caenorhabd...
4KSF_A            311 RWISKI------RD---PKSGFPLSPEDRNTLVLL------------------DDPtwPEDKAR----ADAV--ERILLP 357 Agrobacter...
jgi:Pden_1720     320 AWLAQQ------RK---DAMSELIDADQRLAFAVL------------------DDPdwHKDPAV----AESL--RAPLLA 366 Paracoccus...
jgi:Mrad2831_1479 323 AWLARE------RR---ADSPQGLLPEDVETLRAL------------------DDPawPADKAR----AETV--RRALIP 369 Methylobac...
jgi:Mnod_7252     323 TWLDRE------RR---ADAPQGLTREDVEVLRLL------------------DKPdwHTDKAT----AETV--RKALLP 369 Methylobac...
MSU:OCAR_6806     310 KWLDRQ------LS---A-APAWLTPADIDALESL------------------RQSggIHNDQE----RTRL--ATTLDG 355 Oligotroph...
jgi:Pnuc_0627     288 DWVAAGadvagdKAg--AQLKPAIRTAREHALETLglttr--------swterLSSgwHPDNA-----SEKE--KAALLC 350 Polynucleo...
WP_013695522      303 DWFKSLs---------dNKLANILKNYDIAKVAf------------------------LKSDTVklgdQRIVeeKEAIKK 349 Candidatus...
1_pfamImport      145 NWLMEKikl-----iekGETDVGLSLEIWSPILKHvenwke-------ikrhlHNNtwHHDRNL----ASLF--EPALMS 206
EKC18395          323 TWLIIEinkalnLKdigEHSEELLLLSEIEELKNFlgiseesv--lktvkdliQTHawIQNEQI----CDVI--KKPLMR 394 Pacific oy...
Q20048            294 PWLIRNlk-------gnSEYPSIMNEKVVNWISDIseremneveatetllkviSNEktKKEQ------LNAI--QHILMY 358 Caenorhabd...
4KSF_A            358 LAARYFI--TERTPDnRPVDPVARFHLGNGARLERLNFLGDRSVKAXRQAHGLXVNYLY 414 Agrobacterium vitis S4
jgi:Pden_1720     367 AAAAYFL--RARDGKgRVVDPVARFHLGNGARLERLNFLGDVSANGLKQSHGLMVNYLY 423 Paracoccus denitrificans PD1222
jgi:Mrad2831_1479 370 AAAAYFL--RAKNERgRPLDPVARFHLGNGARLDRINFLGDTSKKGLAQSHGLMVNYLY 426 Methylobacterium radiotolerans ...
jgi:Mnod_7252     370 AAAYYFL--RAKTPRgKPVDPVARFHLGNGARLERLNFLGDVSPKGLAQSYGLMVNYLY 426 Methylobacterium nodulans ORS 2060
MSU:OCAR_6806     356 AAAQYFL--VEKNDHqKPIDPVARFHLGNGARLERLNPFGDTSANGIRQSYGLMVNYLY 412 Oligotropha carboxidovorans OM5
jgi:Pnuc_0627     351 LAGIYLAlgSAGRNG----NPVAKFHLGNGAKLHQINWAGDLSRKGLRQSASLMVNYLY 405 Polynucleobacter asymbioticus Q...
WP_013695522      350 IVVHYLL--NEKNKN-QPLNPVSRFHLGNGASIEDVIINGNVSDYGYQESFGIMVNYIY 405 Candidatus Pelagibacter sp. IMC...
1_pfamImport      207 ACAYYLF--KEKRRG-AALDNVANFHLRNGAVMWRLNWMADTSPRGMTNSCGLMVNYRY 262
EKC18395          395 LCARYLH--REKRRG-FALNPVANFHLGNGAVLWRLNWKADMSIRGINQSCGMMVNYRY 450 Pacific oyster
Q20048            359 ACAHYLC--NAKRNG-MALNSVANFHIRNGAELYRLNWNGDTSHRGINNSFGIMVNYRY 414 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap